ProGP150 (Cytochrome b558/566 subunit A (b type he

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP150 (Cytochrome b558/566 subunit A (b type he
Validation Status Characterized
Organism Information
Organism NameSulfolobus acidocaldarius (DSM 639)
Domain Archaea
Classification Family: Sulfolobaceae
Order: Sulfolobales
Class: Thermoprotei or Crenarchaeota
Division or phylum: "Crenarchaeota"
Taxonomic ID (NCBI) 2285
Genome Information
GenBank CP000077.1
EMBL CP000077
Gene Information
Gene NamecbsA(Saci_1858)
NCBI Gene ID 3474781
GenBank Gene Sequence 68566501
Protein Information
Protein NameCytochrome b558/566 subunit A (b type hemoprotein)
UniProtKB/SwissProt ID O54088
NCBI RefSeq YP_256457.1
EMBL-CDSAAY81164.1
UniProtKB Sequence >sp|O54088|CBSA_SULAC Cytochrome b558/566 subunit A OS=Sulfolobus acidocaldarius GN=cbsA PE=1 SV=1 MSLKIKSKITIGVLLIIFLLSIIFTLENVSLAQTSPQISVYKVVGSADLSNPGSAGYWSQ IPWTNISLTANIPMAPTSGLTHYLLVKAAWNGSWIFILEEWQAPEPAFNAWSTAVAGIYP NASGPGLFRMIELTPGTTYSLERNYTNYVSIINGKEETGRIVFNYSGITLPAPNNTEITV MSNGTILLWHSPRPVEDLLYNDGMFYGYYVNSTWYYPDRAAIMWYLGSGVPTKDDMNIGG KYPGQQFDGITFKDAGGSLAQSGGSANIWMWVSGATWNNSTYDPAFKSNIWQNESLTGLS YVDSGNHGFAVPLYTNNTNMYEVDTAGIWYTPVASEGLNGSLFFIWTGAKYENGSWVVEF ARPLSVPLDYQPFMPNITVGKTYYVAFAVWQGRLGETLFDKSITSSFLSLELVTTPPTST TTSTSPVTTISSAIPPVTLYVTIIGVVVALVALVILYVVFRR
Sequence length 462 AA
Subcellular LocationIntegral Membrane
Function Membrane residing ectoenzyme. Due to the likely pseudoperiplasmic location, cytochrome c-like function is proposed analogous to the situation in Paracoccus denitrificans linking pseudoperiplasmic redox metabolism to membrane-residing electron transport systems. Cytochrome b558/566 is significantly up-regulated under certain organotrophic growth conditions in combination with low oxygen tension.
Glycosylation Status
Glycosylation Type N- (Asn) linked, (O- linked residues not yet identified)
Experimentally Validated Glycosite(s) in Full Length ProteinN144, N164
Experimentally Validated Glycosite(s ) in Mature ProteinN144, N164
Glycosite(s) Annotated Protein Sequence >sp|O54088|CBSA_SULAC Cytochrome b558/566 subunit A OS=Sulfolobus acidocaldarius GN=cbsA PE=1 SV=1 MSLKIKSKITIGVLLIIFLLSIIFTLENVSLAQTSPQISVYKVVGSADLSNPGSAGYWSQ IPWTNISLTANIPMAPTSGLTHYLLVKAAWNGSWIFILEEWQAPEPAFNAWSTAVAGIYP NASGPGLFRMIELTPGTTYSLERN*(144)YTNYVSIINGKEETGRIVFN*(164)YSGITLPAPNNTEITV MSNGTILLWHSPRPVEDLLYNDGMFYGYYVNSTWYYPDRAAIMWYLGSGVPTKDDMNIGG KYPGQQFDGITFKDAGGSLAQSGGSANIWMWVSGATWNNSTYDPAFKSNIWQNESLTGLS YVDSGNHGFAVPLYTNNTNMYEVDTAGIWYTPVASEGLNGSLFFIWTGAKYENGSWVVEF ARPLSVPLDYQPFMPNITVGKTYYVAFAVWQGRLGETLFDKSITSSFLSLELVTTPPTST TTSTSPVTTISSAIPPVTLYVTIIGVVVALVALVILYVVFRR
Sequence Around Glycosites (21 AA) TPGTTYSLERNYTNYVSIING
GKEETGRIVFNYSGITLPAPN
ProGP Web Logo
Technique(s) used for Glycosylation DetectionChemical deglycosylation (with TFMS) and mass shift on SDS-PAGE.
Technique(s) used for Glycosylated Residue(s) Detection MALDI-MS, 1H-NMR spectroscopy of trypsin/pronase digested, anion-exchange HPLC purified glycan linked dipeptides.
Protein Glycosylation- Implication The increased glycosylation of Cytochrome b558/566 subunit A has been suggested to have a role in the protection of enzyme against the harsh acidic conditions (pH 2 - 2.5) of S. acidocaldarius, in its thermoacidophilic habitat. Upon glycosylation with a low pKa sulfonate carrying glycans the protein achieves a negative surface potential at the locus of the cytochrome. The glycosylation of a major internal loop region also may improve resistance against hydrolytic cleavage which is even better than what is acheived from sulfated glycans.
Glycan Information
Glycan Annotation Linkage: β-GlcNAc-Asn.
64-kDa glycoprotein expresses 17% glycosylation. Total sugar analysis revealed the relative proportions of approximately 7:2:2 for mannose, glucose and GlcNAc.
N-linked hexasaccharide units (at least seven)- two residues each of Man and GlcNAc (one trisubstituted) and one residue each of Glc and 6-deoxy-6-sulfoglucose (6-sulfoquinovose- a rare acidic sugar).
β-D-Glcp-(1→4)-β-D-Quip(6--SO3-)-(1→3)-[α-D-Manp(1→4), α-D-Manp(1→6)] β-D-GlcpNAc-(1→4)-β-D-GlcpNAc-(1→Asn....
O-mannosylation with atleast 35 monosaccharides at unidentified residues.
BCSDB ID5950
Technique(s) used for Glycan Identification Identification of oligosaccharides using Gel Chromatography and GLC-MS (PNGase F treatment followed by HPAEC analysis). Glycan structure is elucidated with the help of 1H-NMR spectrum from two-dimensional 1H, 1H correlation NMR Spectroscopy . Linkage analysis was carried out using 13C NMR Chemical Shift analysis.
Protein Glycosylation linked (PGL) gene(s)
OST Gene NameConserved membrane protein
OST ProGT IDProGT51 (AglB)
Literature