ProGP152 (Type A Flagellin)

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP152 (Type A Flagellin)
Validation Status Characterized
Organism Information
Organism NamePseudomonas aeruginosa PAK /5939
Domain Bacteria
Classification Family: Pseudomonadaceae
Order: Pseudomonadales
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 287
Genome Information
GenBank M57501
EMBL M57501
Organism Additional Information It is a Gram-negative opportunistic pathogen that is responsible for nosocomial pneumonia. Its virulence factors include exotoxins, proteases, lipases, lipopolysaccharide (LPS), pili, and flagellin protein.
Gene Information
Gene NamefliC
Protein Information
Protein NameType A Flagellin
UniProtKB/SwissProt ID P21184
EMBL-CDSAAA63458.1
UniProtKB Sequence >sp|P21184|FLICA_PSEAE A-type flagellin OS=Pseudomonas aeruginosa GN=fliC PE=1 SV=3 MALTVNTNIASLNTQRNLNNSSASLNTSLQRLSTGSRINSAKDDAAGLQIANRLTSQVNG LNVATKNANDGISLAQTAEGALQQSTNILQRMRDLSLQSANGSNSDSERTALNGEVKQLQ KELDRISNTTTFGGRKLLDGSFGVASFQVGSAANEIISVGIDEMSAESLNGTYFKADGGG AVTAATASGTVDIAIGITGGSAVNVKVDMKGNETAEQAAAKIAAAVNDANVGIGAFSDGD TISYVSKAGKDGSGAITSAVSGVVIADTGSTGVGTAAGVTPSATAFAKTNDTVAKIDIST AKGAQSAVLVIDEAIKQIDAQRADLGAVQNRFDNTINNLKNIGENVSAARGRIEDTDFAA ETANLTKNQVLQQAGTAILAQANQLPQSVLSLLR
Sequence length 394 AA
Subcellular LocationSecreted
Function Flagellin is the subunit protein which polymerizes to form the filaments of bacterial flagella. It has been shown to have a role in the stimulation of inflammatory response via Toll-like receptor 5.
Glycosylation Status
Glycosylation Type O- (Ser/Thr) linked
Experimentally Validated Glycosite(s) in Full Length Protein(Initiator Met removed) T190, S261
Experimentally Validated Glycosite(s ) in Mature ProteinT189, S260
Glycosite(s) Annotated Protein Sequence >sp|P21184|FLICA_PSEAE A-type flagellin OS=Pseudomonas aeruginosa GN=fliC PE=1 SV=3 MALTVNTNIASLNTQRNLNNSSASLNTSLQRLSTGSRINSAKDDAAGLQIANRLTSQVNG LNVATKNANDGISLAQTAEGALQQSTNILQRMRDLSLQSANGSNSDSERTALNGEVKQLQ KELDRISNTTTFGGRKLLDGSFGVASFQVGSAANEIISVGIDEMSAESLNGTYFKADGGG AVTAATASGT*(190)VDIAIGITGGSAVNVKVDMKGNETAEQAAAKIAAAVNDANVGIGAFSDGD TISYVSKAGKDGSGAITSAVS*(261)GVVIADTGSTGVGTAAGVTPSATAFAKTNDTVAKIDIST AKGAQSAVLVIDEAIKQIDAQRADLGAVQNRFDNTINNLKNIGENVSAARGRIEDTDFAA ETANLTKNQVLQQAGTAILAQANQLPQSVLSLLR
Sequence Around Glycosites (21 AA) GAVTAATASGTVDIAIGITGG
DGSGAITSAVSGVVIADTGST
Technique(s) used for Glycosylation DetectionSlower (and aberrant) migration on SDS-PAGE than its predicted mass, carbohydrate detection and deglycosylation with TFMS
Technique(s) used for Glycosylated Residue(s) Detection LC-ES-MS/MS (liquid chromatography electrospray tandem mass spectrometry) analysis after ?-elimination with ammonium hydroxide
Glycan Information
Glycan Annotation Linkage: Rha-Ser/Thr.
Heterogeneous glycan comprising up to 11 monosaccharide units that are O-linked through a rhamnose (deoxyhexose) residue; rhamnose, mannose, glucose, and 4-amino-4,6-dideoxyglucose (viosamine) as major components with novel, conserved trisaccharide capping. A single rhamnose residue is found at each site in P. aeruginosa JJ692.
BCSDB ID22702
Technique(s) used for Glycan Identification Nanospray MS-MS analyses after HPLC of glycopeptide ions and GC-MS (gas chromatography-mass spectrometry) monosaccharide analysis
Protein Glycosylation linked (PGL) gene(s)
OST Gene NamePilO (TfpO)
OST ProGT IDProGT1 (PilO)
Literature
ReferenceMiller, W.L., Matewish, M.J., McNally, D.J., Ishiyama, N., Anderson, E.M., Brewer, D., Brisson, J.R., Berghuis, A.M. and Lam, J.S. (2008) Flagellin glycosylation in Pseudomonas aeruginosa PAK requires the O-antigen biosynthesis enzyme WbpO. J Biol Chem, 283, 3507-3518. [PubMed: 18065759]
AuthorMiller, W.L., Matewish, M.J., McNally, D.J., Ishiyama, N., Anderson, E.M., Brewer, D., Brisson, J.R., Berghuis, A.M. and Lam, J.S.
Research GroupDepartment of Molecular and Cellular Biology, University of Guelph, Guelph, Ontario N1G 2W1, Canada.
Corresponding Author Lam, J.S.
ContactDepartment of Molecular and Cellular Biology, University of Guelph, Guelph, Ontario N1G 2W1, Canada.
Reference Arora, S.K., Wolfgang, M.C., Lory, S. and Ramphal, R. (2004) Sequence polymorphism in the glycosylation island and flagellins of Pseudomonas aeruginosa. J Bacteriol, 186, 2115-2122. [PubMed: 15028697]
Author Arora, S.K., Wolfgang, M.C., Lory, S. and Ramphal, R
Research GroupDepartment of Medicine and Infectious Diseases, University of Florida, Gainesville, Florida 32610, USA.
Corresponding Author Ramphal, R
ContactDepartment of Medicine and Infectious Diseases, University of Florida, Gainesville, Florida 32610, USA.
Reference Schirm, M., Arora, S.K., Verma, A., Vinogradov, E., Thibault, P., Ramphal, R. and Logan, S.M. (2004) Structural and genetic characterization of glycosylation of type a flagellin in Pseudomonas aeruginosa. J Bacteriol, 186, 2523-2531. [PubMed: 15090491]
Author Schirm, M., Arora, S.K., Verma, A., Vinogradov, E., Thibault, P., Ramphal, R. Logan, S.M.
Research GroupDepartment of Chemistry, University of Montreal, Montreal, Quebec, Canada.
Corresponding Author Logan, S.M.
ContactDepartment of Chemistry, University of Montreal, Montreal, Quebec, Canada.
Reference Arora, S.K., Bangera, M., Lory, S. and Ramphal, R. (2001) A genomic island in Pseudomonas aeruginosa carries the determinants of flagellin glycosylation. Proc Natl Acad Sci U S A, 98, 9342-9347. [PubMed: 11481492]
Author Arora, S.K., Bangera, M., Lory, S. Ramphal, R.
Research GroupDepartment of Medicine/Infectious Diseases, University of Florida, Gainesville, FL 32610, USA
Corresponding Author Ramphal, R.
ContactDepartment of Medicine/Infectious Diseases, University of Florida, Gainesville, FL 32610, USA
Reference Brimer, C.D. and Montie, T.C. (1998) Cloning and comparison of fliC genes and identification of glycosylation in the flagellin of Pseudomonas aeruginosa a-type strains. J Bacteriol, 180, 3209-3217. [PubMed: 9620973]
Author Brimer, C.D. Montie, T.C.
Research GroupDepartment of Microbiology, University of Tennessee, Knoxville 37996-0845, USA.
Corresponding Author Montie, T.C.
ContactDepartment of Microbiology, University of Tennessee, Knoxville 37996-0845, USA.
Reference Totten, P.A. and Lory, S. (1990) Characterization of the type a flagellin gene from Pseudomonas aeruginosa PAK. J Bacteriol, 172, 7188-7199. [PubMed: 2123866]
Author Totten, P.A. and Lory, S.
Research GroupDepartment of Microbiology, School of Medicine, University of Washington, Seattle 98195.
Corresponding Author Lory, S
ContactDepartment of Microbiology, School of Medicine, University of Washington, Seattle 98195.