ProGP158

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP158
Validation Status Uncharacterized
Organism Information
Organism NameMycobacterium bovis BCG strain 1173P2
Domain Bacteria
Classification Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 410289
Genome Sequence(s)
GenBank AM408590.1
EMBL AM408590
Organism Additional Information Mycobacterium bovis is the etiologic agent of bovine tuberculosis.
Gene Information
Gene NamehbhA (BCG_0516)
NCBI Gene ID 4696475
Protein Information
Protein NameHBHA (heparin-binding hemagglutinin)
UniProtKB/SwissProt ID A1KFU9
NCBI RefSeq YP_976614.1
EMBL-CDSCAL70501.1
UniProtKB Sequence >sp|A1KFU9|HBHA_MYCBP Heparin-binding hemagglutinin OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=hbhA PE=1 SV=1 MAENSNIDDIKAPLLAALGAADLALATVNELITNLRERAEETRTDTRSRVEESRARLTKL QEDLPEQLTELREKFTAEELRKAAEGYLEAATSRYNELVERGEAALERLRSQQSFEEVSA RAEGYVDQAVELTQEALGTVASQTRAVGERAAKLVGIELPKKAAPAKKAAPAKKAAPAKK AAAKKAPAKKAAAKKVTQK
Sequence length 199 AA
Subcellular LocationSurface
Function Mycobacterial heparin-binding hemagglutinin (HBHA) functions as an adhesin for epithelial cells and induces bacterial auto-aggregation.Glycosylation of HBHA may protect the protein from proteolytic degradation (crucial for its stabilty), important for HBHA-mediated hemagglutination and for certain immunologic properties of the protein.
Glycosylation Status
Technique(s) used for Glycosylation DetectionMass shift detected on SDS-polyacrylamide gel and carbohydrate content determination by GC/ mass spectrophotometry analysis
Literature
Year of Identification1998
Year of Identification Month Wise1998.08.07
ReferenceMenozzi, F.D., Bischoff, R., Fort, E., Brennan, M.J. and Locht, C. (1998) Molecular characterization of the mycobacterial heparin-binding hemagglutinin, a mycobacterial adhesin. Proc Natl Acad Sci U S A, 95, 12625-12630. [PubMed: 9770536]
AuthorLocht, C.
Research GroupLaboratory of Genetic and Molecular Microbiology, National Institute of Health and Medical Research U447, Institute Pasteur of Lille,
Corresponding Author Menozzi, F.D., Bischoff, R., Fort, E., Brennan, M.J. Locht, C.
ContactLaboratory of Genetic and Molecular Microbiology, National Institute of Health and Medical Research U447, Institute Pasteur of Lille,