ProGP161

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP161
Validation Status Uncharacterized
Organism Information
Organism NameTreponema maltophilum ATCC 51939T
Domain Bacteria
Classification Family: Spirochaetaceae
Order: Spirochaetales
Class: Spirochaetes
Division or phylum: "Spirochaetes" or "Spirochaetae"
Taxonomic ID (NCBI) 51160
Genome Sequence(s)
GenBank Y18889
EMBL Y18889
Gene Information
Gene NameflaB2
Protein Information
Protein NameFlagellar filament 31.3 kDa core protein
UniProtKB/SwissProt ID Q9KWX0
EMBL-CDSCAB67249.1
UniProtKB Sequence >sp|Q9KWX0|FLAB2_TREMA Flagellar filament 31.3 kDa core protein OS=Treponema maltophilum GN=flaB2 PE=1 SV=1 MIINHNMSAMYSNRVLGVTNLAQAKDMEKLSSGMKINRAGDDASGLAVSEKMRSQIRGLN QASRNAQNGISFIQVSEGYLQETTDIMHRIRELAVQSSNGIYSDEDRMQIQVEVSQLVAE VDRIASHAQFNGMNMLTGRFARATGENTVTGSMWLHIGANMDQRMQVFIGTMTAMAVGVR EIGSEKVMSIAAPDDANRAIGTIDEGLKKINKQRADLGAYQNRLEMTVKGLDVAAENTQA AESTIRDTDMAKQMVDFTKNRILAQAGTAMLAQANVTTQNVLTLLQ
Sequence length 286 AA
Subcellular LocationPeriplasm
Function Major component of the endoflagella which are required for motility of Treponemes.
Glycosylation Status
Technique(s) used for Glycosylation DetectionPeriodate oxidation-DIG hydrazide labeling
Literature
Year of Identification1998
Year of Identification Month Wise1998.09.28
ReferenceWyss, C. (1998) Flagellins, but not endoflagellar sheath proteins, of Treponema pallidum and of pathogen-related oral spirochetes are glycosylated. Infect Immun, 66, 5751-5754. [PubMed: 9826350]
AuthorWyss, C.
Research GroupInstitute of Oral Microbiology and General Immunology, Center for Dental, Oral and Maxillofacial Surgery, University of Zurich, CH-8028 Zurich, Switzerland.
Corresponding Author Wyss, C.
ContactInstitute of Oral Microbiology and General Immunology, Center for Dental, Oral and Maxillofacial Surgery, University of Zurich, CH-8028 Zurich, Switzerland.