ProGP161

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP161
Validation Status Uncharacterized
Organism Information
Organism NameTreponema maltophilum ATCC 51939T
Domain Bacteria
Classification Family: Spirochaetaceae
Order: Spirochaetales
Class: Spirochaetes
Division or phylum: "Spirochaetes" or "Spirochaetae"
Taxonomic ID (NCBI) 51160
Genome Sequence(s)
EMBL Y18889
Gene Information
Gene NameflaB2
Protein Information
Protein NameFlagellar filament 31.3 kDa core protein
UniProtKB/SwissProt ID Q9KWX0
EMBL-CDSCAB67249.1
UniProtKB Sequence >sp|Q9KWX0|FLAB2_TREMA Flagellar filament 31.3 kDa core protein OS=Treponema maltophilum GN=flaB2 PE=1 SV=1 MIINHNMSAMYSNRVLGVTNLAQAKDMEKLSSGMKINRAGDDASGLAVSEKMRSQIRGLN QASRNAQNGISFIQVSEGYLQETTDIMHRIRELAVQSSNGIYSDEDRMQIQVEVSQLVAE VDRIASHAQFNGMNMLTGRFARATGENTVTGSMWLHIGANMDQRMQVFIGTMTAMAVGVR EIGSEKVMSIAAPDDANRAIGTIDEGLKKINKQRADLGAYQNRLEMTVKGLDVAAENTQA AESTIRDTDMAKQMVDFTKNRILAQAGTAMLAQANVTTQNVLTLLQ
Sequence length 286 AA
Subcellular LocationPeriplasm
Function Major component of the endoflagella which are required for motility of Treponemes.
Glycosylation Status
Glycosylation Type Information currently not available with us.
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionPeriodate oxidation-DIG hydrazide labeling
Literature
Additional CommentFlagellar filament 30.7 kDa core protein (FlaB3) is also glycosylated. Its UniProtKB ID is Q9KWW9.
Year of Identification1998
Year of Identification Month Wise1998.09.28
Reference1) Wyss, C. (1998) Flagellins, but not endoflagellar sheath proteins, of Treponema pallidum and of pathogen-related oral spirochetes are glycosylated. Infect Immun, 66, 5751-5754. [PubMed: 9826350]
AuthorWyss, C.
Research GroupInstitut für Orale Mikrobiologie und Allgemeine Immunologie, Zentrum für Zahn-, Mund- und Kieferheilkunde der Universität Z urich, CH-8028 Zürich, Switzerland.
Corresponding Author Wyss, C.
ContactInstitut für Orale Mikrobiologie und Allgemeine Immunologie, Zentrum für Zahn-, Mund- und Kieferheilkunde der Universität Z urich, CH-8028 Zürich, Switzerland.