ProGP170 (Cysteine proteases (extracellular) Arg-g

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP170 (Cysteine proteases (extracellular) Arg-g
Validation Status Uncharacterized
Organism Information
Organism NamePorphyromonas gingivalis W50
Domain Bacteria
Classification Family: Porphyromonadaceae
Order: Bacteroidales
Class: Bacteroidia
Division or phylum: "Bacteroidetes"
Taxonomic ID (NCBI) 837
Genome Information
GenBank D26470
EMBL D26470
Organism Additional Information Porphyromonas gingivalis is a Gram-negative anaerobic bacterium responsible for causing adult periodontal disease, a chronic inflammatory condition of the periodontal tissues. It is the source of a number of virulence factors that are thought to be important for deregulation of innate and inflammatory systems in the host.
Gene Information
Gene NamergpA
Protein Information
Protein NameCysteine proteases (extracellular) Arg-gingipains (RgpA)
UniProtKB/SwissProt ID P28784
EMBL-CDSBAA05484.1
UniProtKB Sequence >sp|P28784|CPG1_PORGI Gingipain R1 OS=Porphyromonas gingivalis GN=rgpA PE=1 SV=2 MKNLNKFVSIALCSSLLGGMAFAQQTELGRNPNVRLLESTQQSVTKVQFRMDNLKFTEVQ TPKGMAQVPTYTEGVNLSEKGMPTLPILSRSLAVSDTREMKVEVVSSKFIEKKNVLIAPS KGMIMRNEDPKKIPYVYGKSYSQNKFFPGEIATLDDPFILRDVRGQVVNFAPLQYNPVTK TLRIYTEITVAVSETSEQGKNILNKKGTFAGFEDTYKRMFMNYEPGRYTPVEEKQNGRMI VIVAKKYEGDIKDFVDWKNQRGLRTEVKVAEDIASPVTANAIQQFVKQEYEKEGNDLTYV LLVGDHKDIPAKITPGIKSDQVYGQIVGNDHYNEVFIGRFSCESKEDLKTQIDRTIHYER NITTEDKWLGQALCIASAEGGPSADNGESDIQHENVIANLLTQYGYTKIIKCYDPGVTPK NIIDAFNGGISLVNYTGHGSETAWGTSHFGTTHVKQLTNSNQLPFIFDVACVNGDFLFSM PCFAEALMRAQKDGKPTGTVAIIASTINQSWASPMRGQDEMNEILCEKHPNNIKRTFGGV TMNGMFAMVEKYKKDGEKMLDTWTVFGDPSLLVRTLVPTKMQVTAPAQINLTDASVNVSC DYNGAIATISANGKMFGSAVVENGTATINLTGLTNESTLTLTVVGYNKETVIKTINTNGE PNPYQPVSNLTATTQGQKVTLKWDAPSTKTNATTNTARSVDGIRELVLLSVSDAPELLRS GQAEIVLEAHDVWNDGSGYQILLDADHDQYGQVIPSDTHTLWPNCSVPANLFAPFEYTVP ENADPSCSPTNMIMDGTASVNIPAGTYDFAIAAPQANAKIWIAGQGPTKEDDYVFEAGKK YHFLMKKMGSGDGTELTISEGGGSDYTYTVYRDGTKIKEGLTETTYRDAGMSAQSHEYCV EVKYAAGVSPKVCVDYIPDGVADVTAQKPYTLTVVGKTITVTCQGEAMIYDMNGRRLAAG RNTVVYTAQGGYYAVMVVVDGKSYVEKLAVK
Sequence length 991 AA
Subcellular LocationExtracellular
Function Cysteine proteases cause the degradation of several physiologically important proteins, including collagens, fibrin and fibrinogen and fibronectin. They also account for deregulatory effects on several host systems and are therefore considered important virulence determinants. The adhesin domains of Arg-gingipains mediate the adherence of P. gingivalis to epithelial cells.
Glycosylation Status
Technique(s) used for Glycosylation DetectionPAS staining, biotin hydrazide labelling following periodate oxidation and subsequent abolishment of immunoreactivity wth MAb 1B5 and MAb 7B4 after deglycosylation.
Glycan Information
Glycan Annotation Linkage: GalN(Ac)-Ser/Thr. Ara, Rha, Fuc,Man, Gal, Glc, GalN(Ac), GlcN(Ac), and N-acetylneuraminic acid (NANA) totalling 14.4% by weight of protein. The glycan chains are structurally and immunologically related to the cell surface polymer of this Gram-negative bacterium.
Literature
Year of Identification1999
Year of Identification Month Wise1999.5