ProGP174

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP174
Validation Status Uncharacterized
Organism Information
Organism NameSulfolobus solfataricus P2
Domain Archaea
Classification Family: Sulfolobaceae
Order: Sulfolobales
Class: Thermoprotei or Crenarchaeota
Division or phylum: "Crenarchaeota"
Taxonomic ID (NCBI) 2287
Genome Sequence(s)
GenBank AE006641.1
EMBL AE006641
Gene Information
Gene NameSSO2847 or glcS
NCBI Gene ID 1452876
Protein Information
Protein NameGBP (Glucose binding protein)/ GlcS
UniProtKB/SwissProt ID Q97UZ1
NCBI RefSeq NP_344167.1
EMBL-CDSAAK42957.1
UniProtKB Sequence >tr|Q97UZ1|Q97UZ1_SULSO Sugar-binding periplasmic protein OS=Sulfolobus solfataricus GN=SSO2847 PE=4 SV=1 MKRKYPYSLAKGLTSTQIAVIVAVIVIVIIIGVVAGFVLTKGPSTTAVTTTVTSTFTTTT TIPSTTTSTPSNTVVFYTWWGGGDGGEALSQIIPAVKQYAGLQMQTYSIPGAGGTNAKYA ILALIQAGKPPAAFQVHYGPEMISYVEAAPNGIHTFVNMTPYLIQWGLLNNAVYAVLQAG AYNGTLLSVPINVHRGAVLYVNTQLLREYNLPFPYNFSTLVYDTVQLANHGVSPWIIPGG DGGWDQFNVWEDIFLYLAGPQLYNELIYGTLNFSNPTVQKLINETNYWFLNFTSYNYPGW QSMSWEQAFALIAQGKVAFQANGNWVTNYASYINVTVYPPLPQYISNSSVSVVETPFPGT QHYYALVIDTIGIPVGPQEQQALQLAHFWSSYQGQEVWTKYKAVTYYKNGTDWYAQPAQW YDYQQLINTSEQNFVYQLSDGGVFDDVFAQIDSGLLTLQQVGKVGLSAWNSTLVSSMQQE QNEWLAAAKLGLGYLGFPGHPFAGYYPPWVTNPSAYGLTNNTQKTSNSVMLFLLPFLALP LAIASIDNKYYLLK
Sequence length 554 AA
Subcellular LocationMembrane associated
Function GBP is a subunit of an ABC transport system. It is a sugar-binding periplasmic protein with high affinity for glucose.
Glycosylation Status
Technique(s) used for Glycosylation DetectionConA-Sepharose affinity chromatography.
Literature
Year of Identification1999
Year of Identification Month Wise1999.7
ReferenceAlbers, S.V., Elferink, M.G., Charlebois, R.L., Sensen, C.W., Driessen, A.J. and Konings, W.N. (1999) Glucose transport in the extremely thermoacidophilic Sulfolobus solfataricus involves a high-affinity membrane-integrated binding protein. J Bacteriol, 181, 4285-4291. [PubMed: 10400586]
AuthorAlbers, S.V., Elferink, M.G., Charlebois, R.L., Sensen, C.W., Driessen, A.J. and Konings, W.N
Research GroupDepartment of Microbiology, Groningen Biomolecular Sciences and Biotechnology Institute, University of Groningen, 9751 NN Haren, The Netherlands
Corresponding Author Konings, W.N
ContactDepartment of Microbiology, Groningen Biomolecular Sciences and Biotechnology Institute, University of Groningen, 9751 NN Haren, The Netherlands