ProGP175

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP175
Validation Status Uncharacterized
Organism Information
Organism NameHelicobacter felis CS1
Domain Bacteria
Classification Family: Helicobacteraceae
Order: Campylobacterales
Class: Epsilonproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 936155
Genome Sequence(s)
GenBank FQ670179.2
EMBL FQ670179
Gene Information
Gene NameflaA (Hfelis_04060)
NCBI Gene ID 10050848
Protein Information
Protein NameFlagellin A
UniProtKB/SwissProt ID Q9XB38
NCBI RefSeq YP_004073080.1
EMBL-CDSCBY82490.1
UniProtKB Sequence >sp|Q9XB38|FLAA_HELFC Flagellin A OS=Helicobacter felis (strain ATCC 49179 / NCTC 12436 / CS1) GN=flaA PE=3 SV=3 MAFQVNTNINALNAHAMGLVTQRELKESLERLSSGLRINKAADDASGMTIADSLRSQAKS LGQAIANTNDGMGIIQIADKAMDEQIKILDTIKVKATQAAQDGQNTQSRKALQADIVRLI QSLDNIGNTTSYNGQTLLSGAFSNKEFQVGAYSNETIKASIGSATSDKIGQVKITTGKNI TASGEVALTFKQVDGVHDVSLESVKISTSAGTGLGVLAEVINKNSNATGVRATANVITTS DSAIKSGSLSSLTVNGIEIGNILGIKKNDSDGRLVAALNAVTAQTGVEAYTDSVGRLNLR SIDGRGINIKANSTNVDGQASALTTLNGGQDITRGSTNFGRLSLVRQDARDILVVSGANV SASAGYAAIGFAKGTTANTTVNLRDVLGEFNQAVRSASGANYNKTLASENLTLGSGVTTL RGAMVVMDIAESAQKMLDKVRSDLGSVQNQMVSTVNNITITQVNVKAAESQIRDVDFAQE SANFSKNNILAQSGSYAMSQANTVQQNILRLLT
Sequence length 513 AA
Subcellular LocationSecreted
Function FlaA and FlaB are co-assembled into one flagellar flament. H. felis flaA mutants possess truncated sheathed flagella and are unable to colonize murine stomach.
Glycosylation Status
Technique(s) used for Glycosylation DetectionDIG (digoxigenin)-tagged hydrazine labeling after periodate treatment.
Literature
Year of Identification1999
Year of Identification Month Wise1999.7
ReferenceJosenhans, C., Ferrero, R.L., Labigne, A. and Suerbaum, S. (1999) Cloning and allelic exchange mutagenesis of two flagellin genes of Helicobacter felis. Mol Microbiol, 33, 350-362. [PubMed: 10411751]
AuthorSuerbaum, S.
Research GroupRuhr-University Bochum, Department of Medical Microbiology, D-44780 Bochum, Germany.
Corresponding Author Josenhans, C., Ferrero, R.L., Labigne, A. Suerbaum, S.
ContactRuhr-University Bochum, Department of Medical Microbiology, D-44780 Bochum, Germany.