ProGP177

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP177
Validation Status Uncharacterized
Organism Information
Organism NameEscherichia coli (ETEC) strain H10407
Domain Bacteria
Classification Family: Enterobacteriaceae
Order: "Enterobacteriales"
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 316401
Genome Sequence(s)
GenBank FN649414
EMBL FN649414
Organism Additional Information Escherichia coli (Gram-negative) is the predominant facultative organism in the human intestine. It is responsible for a number of diseases like urinary tract infections, gastroenteritis (diarrhoea), meningitis, traveler's diarrhea andhemorrhagic colitis. There are a myriad of serotypes of pathogenic E. coli. Adhesion to the host cells is an important step in its pathogenesis. However, most strains are harmless and normal flora residing in the gut.
Gene Information
Gene NametibA (ETEC_2141)
Protein Information
Protein NameTibA (outer membrane protein synthesized as preTibA)
UniProtKB/SwissProt ID Q9XD84
EMBL-CDSCBJ01643.1
UniProtKB Sequence >sp|Q9XD84|TIBA_ECOLX Adhesin/invasin TibA autotransporter OS=Escherichia coli GN=tibA PE=1 SV=1 MNKVYNTVWNESTGTWVVTSELTRKGGLRPRQIKRTVLAGLIAGLLMPSMPALAAAYDNQ TIGRGETSKSMHLSAGDTAKNTTINSGGKQYVSSGGSATSTTINIGGVQHVSSGGSATSS TINSGGHQHVSSGGSATNTTVNNGGRQTVFSGGSAMGTIINSGGDQYVISGGSATSASVT SGARQFVSSGGIVKATSVNSGGRQYVRDGGSATDTVLNNTGRQFVSSGGSAAKTTINSGG GMYLYGGSATGTSIYNGGRQYVSSGGSATNTTVYSGGRQHVYIDGNVTETTITSGGMLQV EAGGSASKVIQNSGGAVITNTSAAVSGTNDNGSFSIAGGSAVNMLLENGGYLTVFDGHQA SDTMVGSDGTLDVRSGGVLYGTTTLTDKGALVGDVVTNEGNLYYLNNSTATFTGTLTGTG TLTQEGGNTRFSGLLSQDGGIFLQSGGAMTMDALQAKANVTTQSGTTLTLDNGTILTGNV AGDSTGAGDMAVKGASVWHLDGDSTVGALTLDNGTVDFRPSTTTRMTPAFQAVSLALGSL SGSGTFQMNTDIASHTGDMLNVAGNASGNFVLDIKNTGLEPVSAGAPLQVVQTGGGDAAF TLKGGKVDAGTWEYGLSKENTNWYLKADTPPPVTPPTNPDADNPDAGNPDAGNPDAGNPD AGNPDAGKPGTGKPDAGTSSSPVRRTTKSVDAVLGMATAPAYVFNSELDNLRFRHGDVMQ NTRAPGGVWGRYTGSDNRISGGASSGYTLTQNGFETGADMVFDLSDSSLAVGTFFSYSDN SIKHARGGKSNVDSSGGGLYATWFDNDGYYVDGVLKYNRFNNELRTWMSDGTAVKGDYSQ NGFGGSLEAGRTFSLNENAWAQPYVRTTAFRADKKEIRLNNGMKASIGATKSLQAEAGLK LGMTLDVAGKEVKPYLSAAVSHEFSDNNKVRINDTYDFRNDISGTTGKYGLGVNAQLTPN AGVWAEARYENGKQTESPITGGVGFRINF
Sequence length 989 AA
Subcellular LocationSecreted (surface associated)
Function Adhesion-invasion protein of enterotoxigenic E. coli. Secreted as autotransporter, which represents a branch of the type V secretion pathway. Mediates bacterial autoaggregation and biofilm formation as well as adhesion to and invasion of mammalian cells.
Glycosylation Status
Technique(s) used for Glycosylation DetectionOxidation of the glycans with periodate and labeling with hydrazide-conjugated digoxigenin (DIG).
Glycan Information
Glycan Annotation 6-deoxy-Tal-Thr. Multiple heptoses.
Protein Glycosylation linked (PGL) gene(s)
OST ProGT IDProGT9
Literature
Year of Identification1999
Year of Identification Month Wise1999.8
ReferenceLindenthal, C. and Elsinghorst, E.A. (1999) Identification of a glycoprotein produced by enterotoxigenic Escherichia coli. Infect Immun, 67, 4084-4091. [PubMed: 10417177]
AuthorElsinghorst, E.A.
Research GroupDepartment of Molecular Biosciences, University of Kansas, Lawrence, Kansas 66045-2106, USA.
Corresponding Author Lindenthal, C. Elsinghorst, E.A.
ContactDepartment of Molecular Biosciences, University of Kansas, Lawrence, Kansas 66045-2106, USA.