ProGP18

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP18
Validation Status Characterized
Organism Information
Organism NameGeobacillus stearothermophilus NRS 2004/3a
Domain Bacteria
Classification Family: Bacillaceae
Order: Bacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI) 1422
Genome Sequence(s)
EMBL AF328862
Gene Information
Gene NamesgsE
Protein Information
Protein NameS-layer glycoprotein SgsE
UniProtKB/SwissProt ID Q8VTF1
EMBL-CDSAAL46630.1
UniProtKB Sequence >tr|Q8VTF1|Q8VTF1_BACST Surface layer glycoprotein SgsE OS=Bacillus stearothermophilus GN=sgsE PE=3 SV=1 MDKKKAVKLATASAVAASAFVAANPHTSQAATDVATVVSQAKAQMKEAYYTYSHTVTETG QFPDIKDVYAAYNKAKQAYANAVAVVNKAGGAKKDAYLADLQATYETYVFKANPKSGEAR VATYIDAYNYATKLDKMRQELKAAVDAKDLKKAEELYHKISYELKTRTVILDRVYGQSTR ELLRSTFKADAQALRDSLIYDITVAMKAREAQDAVKAGNLDKAKAALDQVNQYVSKVTDA FKAELQKAAQDAKAAYEAALPPKVESVTAVNAKTLEIKFNKAVDAATVIDNKGTSDTSDD VVKATAITLKAIDDQVPVSTVKASLSDDKKTLKLVVDGAQFFTKRYVVDIKNVKTLDGKD VPAYTTTIDTTDSVRPSVLSFSYADNGLTLKVKFSEPLASVGTVKLYDGTTEISVSPKFT AGDDEMTINLASSSVPVNKDLTLKIFGAVDYNGNVINPNPAELTVKKTTVDITKPVVQSI EAVNTKTVKVTFSEKLLSAPTIKIGGQTASVSVDSTGLVYTATLASALSKGVYAVEVSDY KDLAGNSGDAYTKVVQLKADNTAPKFVSSQVVKINGVEHLVLTFDEEVTTGSNITVVQSS DKYIDENNVLKAVGADLKTTSDNFKLYLPTDGKSKSVALNISSLPKGTYTVTLPNGLVSD LADNPYAERKQITFVRGSDSLTTKPALDKDYDSNGVKADNNNELVFAFTQNLDASALNLS NFNINGLTVTKAVFDGDTKHIRVTLAPGANTWTGTHVITISNIKNTSGLVMDTVTVNEYM KENVAPTFTATLTSADVIRVDFSEPVANATISRALSANNFIVKVDGNVVTVSNVYEDNNA TNLVQGSKGYKTVYLKLQSPVTDLSKPITLSATDIVDVNQTGAITDNNVVGNNVSATVVN VAK
Sequence length 903 AA
Subcellular LocationSurface
Glycosylation Status
Glycosylation Type O (Ser/Thr) linked
Experimentally Validated Glycosite(s) in Full Length ProteinT590, T620, S794
Experimentally Validated Glycosite(s ) in Mature ProteinT590, T620, S794
Glycosite(s) Annotated Protein Sequence >tr|Q8VTF1|Q8VTF1_BACST Surface layer glycoprotein SgsE OS=Bacillus stearothermophilus GN=sgsE PE=3 SV=1 MDKKKAVKLATASAVAASAFVAANPHTSQAATDVATVVSQAKAQMKEAYYTYSHTVTETG QFPDIKDVYAAYNKAKQAYANAVAVVNKAGGAKKDAYLADLQATYETYVFKANPKSGEAR VATYIDAYNYATKLDKMRQELKAAVDAKDLKKAEELYHKISYELKTRTVILDRVYGQSTR ELLRSTFKADAQALRDSLIYDITVAMKAREAQDAVKAGNLDKAKAALDQVNQYVSKVTDA FKAELQKAAQDAKAAYEAALPPKVESVTAVNAKTLEIKFNKAVDAATVIDNKGTSDTSDD VVKATAITLKAIDDQVPVSTVKASLSDDKKTLKLVVDGAQFFTKRYVVDIKNVKTLDGKD VPAYTTTIDTTDSVRPSVLSFSYADNGLTLKVKFSEPLASVGTVKLYDGTTEISVSPKFT AGDDEMTINLASSSVPVNKDLTLKIFGAVDYNGNVINPNPAELTVKKTTVDITKPVVQSI EAVNTKTVKVTFSEKLLSAPTIKIGGQTASVSVDSTGLVYTATLASALSKGVYAVEVSDY KDLAGNSGDAYTKVVQLKADNTAPKFVSSQVVKINGVEHLVLTFDEEVTT*(590)GSNITVVQSS DKYIDENNVLKAVGADLKTT*(620)SDNFKLYLPTDGKSKSVALNISSLPKGTYTVTLPNGLVSD LADNPYAERKQITFVRGSDSLTTKPALDKDYDSNGVKADNNNELVFAFTQNLDASALNLS NFNINGLTVTKAVFDGDTKHIRVTLAPGANTWTGTHVITISNIKNTSGLVMDTVTVNEYM KENVAPTFTATLTS*(794)ADVIRVDFSEPVANATISRALSANNFIVKVDGNVVTVSNVYEDNNA TNLVQGSKGYKTVYLKLQSPVTDLSKPITLSATDIVDVNQTGAITDNNVVGNNVSATVVN VAK
Sequence Around Glycosites (21 AA) LVLTFDEEVTTGSNITVVQSS
LKAVGADLKTTSDNFKLYLPT
VAPTFTATLTSADVIRVDFSE
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionPeriodic acid-Schiff (PAS) staining and carbohydrate content determination using orcinol-sulfuric acid assay
Technique(s) used for Glycosylated Residue(s) Detection Edman degradation (of glycopeptides and deglycosylated peptides) and nano-ESI-QTOF-MS/MS (electrospray ionization-quadrupole time of flight tandem mass spectrometry)
Glycan Information
Glycan Annotation Linkage: β-D-Galp-Ser/Thr.
[→2)-α-L-Rhap-(1→3)-β-L-Rhap-(1→2)-α-L-Rhap-(1→]n =13–18 (15 on average), with a 2-Omethyl group capping the terminal trisaccharide repeating unit at the non-reducing end of the glycan chains. The glycan chains are bound via the disaccharide (or trisaccharide with additional α-L-Rhap) core→3)-α-L-Rhap-(1→3)-α-L-Rhap-(1→and the linkage glycose β-D-Galp. Approx. 3.6% sugar content detected. Three inherently heterogeneic glycoprotein species of SgsE, 101.66 kDa, 108.68 kDa, and 115.73 kDa, have been determined. Nanoheterogeneity has been assigned to the S-layer glycans, with the most prevalent variation between 12 and 18 trisaccharide repeating units. One, two and three glycosylation sites, respectively, are occupied in these three glycoprotein species.
BCSDB ID22701
Technique(s) used for Glycan Identification HPAEC/PAD (high performance anion-exchange chromatography/pulsed amperometric detection), MALDI-TOF MS analysis, 1D and 2D 1H and 13C NMR spectroscopy including 2D NOESY (nuclear Overhauser enhancement spectroscopy) and HMBC (heteronuclear multiple bond correlation spectroscopy)
Literature
Year of Identification1984
Year of Identification Month Wise1984
Year of Validation 2002
Reference Schaffer, C., Wugeditsch, T., Kahlig, H., Scheberl, A., Zayni, S. and Messner, P. (2002) The surface layer (S-layer) glycoprotein of Geobacillus stearothermophilus NRS 2004/3a. Analysis of its glycosylation. J Biol Chem, 277, 6230-6239. [PubMed: 11741945]
Author Schaffer, C., Wugeditsch, T., Kahlig, H., Scheberl, A., Zayni, S. and Messner, P.
Research GroupZentrum für Ultrastrukturforschung und Ludwig Boltzmann-Institut für Molekulare Nanotechnologie, Universität für Bodenkultur Wien, A-1180 Wien, Austria. crs@edv1.boku.ac.at
Corresponding Author Messner, P
ContactZentrum für Ultrastrukturforschung und Ludwig Boltzmann-Institut für Molekulare Nanotechnologie, Universität für Bodenkultur Wien, A-1180 Wien, Austria. crs@edv1.boku.ac.at
Reference Steiner, K., Novotny, R., Werz, D.B., Zarschler, K., Seeberger, P.H., Hofinger, A., Kosma, P., Schaffer, C. and Messner, P. (2008) Molecular basis of S-layer glycoprotein glycan biosynthesis in Geobacillus stearothermophilus. J Biol Chem, 283, 21120-21133. [PubMed: 18515358]
Author Steiner, K., Novotny, R., Werz, D.B., Zarschler, K., Seeberger, P.H., Hofinger, A., Kosma, P., Schaffer, C. Messner, P.
Research GroupCenter for NanoBiotechnology, University of Natural Resources and Applied Life Sciences, Vienna, Austria.
Corresponding Author Messner, P.
ContactCenter for NanoBiotechnology, University of Natural Resources and Applied Life Sciences, Vienna, Austria.
Reference Steiner, K., Novotny, R., Werz, D.B., Zarschler, K., Seeberger, P.H., Hofinger, A., Kosma, P., Schaffer, C. and Messner, P. (2008) Molecular basis of S-layer glycoprotein glycan biosynthesis in Geobacillus stearothermophilus. J Biol Chem, 283, 21120-21133. [PubMed: 18515358]
Author Steiner, K., Novotny, R., Werz, D.B., Zarschler, K., Seeberger, P.H., Hofinger, A., Kosma, P., Schaffer, C. Messner, P.
Research GroupCenter for NanoBiotechnology, University of Natural Resources and Applied Life Sciences, Vienna, Austria.
Corresponding Author Messner, P.
ContactCenter for NanoBiotechnology, University of Natural Resources and Applied Life Sciences, Vienna, Austria.
Reference Steiner, K., Novotny, R., Patel, K., Vinogradov, E., Whitfield, C., Valvano, M.A., Messner, P. and Schaffer, C. (2007) Functional characterization of the initiation enzyme of S-layer glycoprotein glycan biosynthesis in Geobacillus stearothermophilus NRS 2004/3a. J Bacteriol, 189, 2590-2598. [PubMed: 17237178]
Author Schaffer, C.
Research GroupZentrum für NanoBiotechnologie, Universität für Bodenkultur Wien, A-1180 Wien, Austria
Corresponding Author Steiner, K., Novotny, R., Patel, K., Vinogradov, E., Whitfield, C., Valvano, M.A., Messner, P. Schaffer, C.
ContactZentrum für NanoBiotechnologie, Universität für Bodenkultur Wien, A-1180 Wien, Austria
Reference Novotny, R., Schaffer, C., Strauss, J. and Messner, P. (2004) S-layer glycan-specific loci on the chromosome of Geobacillus stearothermophilus NRS 2004/3a and dTDP-L-rhamnose biosynthesis potential of G. stearothermophilus strains. Microbiology, 150, 953-965. [PubMed: 15073305]
Author Novotny, R., Schaffer, C., Strauss, J. Messner, P.
Research GroupCenter for NanoBiotechnology, University of Applied Life Sciences and Natural Resources, A-1180 Vienna, Austria.
Corresponding Author Messner, P.
ContactCenter for NanoBiotechnology, University of Applied Life Sciences and Natural Resources, A-1180 Vienna, Austria.
Reference1) Messner, P., Steiner, K., Zarschler, K. and Schaffer, C. (2008) S-layer nanoglycobiology of bacteria. Carbohydr Res, 343, 1934-1951. [PubMed: 18336801]
Author Messner, P., Steiner, K., Zarschler, K. and Schaffer, C.
Research GroupUniversität für Bodenkultur Wien, Zentrum für NanoBiotechnologie A-1180 Wien, Gregor-Mendel-Strasse 33, Austria. paul.messner@boku.ac.at
Corresponding Author Schaffer, C
ContactUniversität für Bodenkultur Wien, Zentrum für NanoBiotechnologie A-1180 Wien, Gregor-Mendel-Strasse 33, Austria. paul.messner@boku.ac.at
Reference Steiner, K., Pohlentz, G., Dreisewerd, K., Berkenkamp, S., Messner, P., Peter-Katalinic, J. and Schaffer, C. (2006) New insights into the glycosylation of the surface layer protein SgsE from Geobacillus stearothermophilus NRS 2004/3a. J Bacteriol, 188, 7914-7921. [PubMed: 16963578]
Author Steiner, K., Pohlentz, G., Dreisewerd, K., Berkenkamp, S., Messner, P., Peter-Katalinic, J. Schaffer, C.
Research GroupEdinburgh, UK.
Corresponding Author Schaffer, C.
ContactEdinburgh, UK.
Reference Kupcu, Z., Marz, L., Messner, P. and Sleytr, U.B. (1984) Evidence for the glycoprotein nature of the crystalline cell wall surface layer of Bacillus stearothermophilus strain NRS2004/3a. FEBS Lett, 173, 185-190. [PubMed: 6745426]