ProGP182

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP182
Validation Status Uncharacterized
Organism Information
Organism NameEhrlichia canis isolate Oklahoma
Domain Bacteria
Classification Family: Anaplasmataceae
Order: Rickettsiales
Class: Alphaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 944
Genome Sequence(s)
EMBL AF112369
Gene Information
Gene Namep140
Protein Information
Protein NameP140 (140 kDa protein)
UniProtKB/SwissProt ID Q9X4J3
EMBL-CDSAAD34330.1
UniProtKB Sequence >tr|Q9X4J3|Q9X4J3_EHRCA 120-kDa protein OS=Ehrlichia canis GN=p140 PE=4 SV=1 MDIDNNNVTTSSTQDKSGNLMEVIMRILNFGNNSDEKVSNEDTKVLVESLQPAVNDNVGN PSSEVGKEENAPEVKAEDLQPAVDGSVEHSSSEVGKKVSETSKEESTPEVKAEDLQPAVD GSIEHSSSEVGEKVSKTSKEESTPEVKAEDLQPAVDDSVEHSSSEVGEKVSETSKEENTP EVKAEDLQPAVDGSIEHSSSEVGEKVSKTSKEESTPEVKAEDLQPAVDDSVEHSSSEVGE KVSETSKEENTPEVKAEDLQPAVDGSVEHSSSEVGKKVSETSKEESTPEVKAEDLQPAVD DSVEHSSSEVGEKVSETSKEENTPEVRAEDLQPAVDGSVEHSSSEVGEKVSETSKEESTP EVKAEDLQPAVDSSIEHSSSEVGKKVSETSKEESTPEVKAEDLQPAVDGSVEHSSSEVGE KVSETSKEENTPEVKAEDLQPAVDGSVEHSSSEVGEKVSETSKEENTPEVKAEDLQPAVD GSVEHSSSEVGEKVSETSKEESTPEVKAEDLQPAVDDSVEHSSSEVGEKVSETSKEESTP EVKAEDLQPAVDGSVEHSSSEVGEKVSETSKEESTPEVKAEVQPVADGNPVPLNPMPSID NIDTNIIFHYHKDCKKGSAVGTDEMCCPVSELMAGEHVHMYGIYVYRVQSVKDLSGVFNI DHSTCDCNLDVYFVGYNSFTNKETVDLI
Sequence length 688 AA
Subcellular LocationSurface
Function Immunodominant surface protein.
Glycosylation Status
Glycosylation Type Information currently not available with us.
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionGlycoprotein detection kit using periodate.
Literature
Year of Identification2000
Year of Identification Month Wise2000.01
Reference1) McBride, J.W., Yu, X.J. and Walker, D.H. (2000) Glycosylation of homologous immunodominant proteins of Ehrlichia chaffeensis and Ehrlichia canis. Infect Immun, 68, 13-18. [PubMed: 10603362]
Author Walker, D.H.
Research GroupDepartment of Pathology and WHO Collaborating Center for Tropical Diseases, University of Texas Medical Branch, Galveston, Texas 
Corresponding Author McBride, J.W., Yu, X.J. Walker, D.H.
ContactDepartment of Pathology and WHO Collaborating Center for Tropical Diseases, University of Texas Medical Branch, Galveston, Texas