ProGP183

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP183
Validation Status Uncharacterized
Organism Information
Organism NameEhrlichia chaffeensis strain Arkansas
Domain Bacteria
Classification Family: Anaplasmataceae
Order: Rickettsiales
Class: Alphaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 945
Genome Sequence(s)
EMBL AF474898
Gene Information
Gene Namep120
Protein Information
Protein NameP120 (120 kDa protein)
UniProtKB/SwissProt ID Q46976
EMBL-CDSAAO12927.1
UniProtKB Sequence >tr|Q46976|Q46976_EHRCH 120 kDa immunodominant surface protein OS=Ehrlichia chaffeensis PE=4 SV=2 MDIDNSNISTADIRSNTDGLIDIIMRILGFGNKNIVQPQDLGSEIYQQEQEDDTVSQPSL EPFVAESEVSKVEQEKTNPEVLIKDLQDVASHESGVSDQPAQVVTERENEIESHQGETEK ESGITESHQKEDEIVSQSSSEPFVAESEVSKVEQEETNPEVLIKDLQDVASHESGVSDQP AQVVTERESEIESHQGETEKESGITESHQKEDEIVSQPSSEPFVAESEVSKVEQEETNPE VLIKDLQDVASHESGVSDQPAQVVTERESEIESHQGETEKESGITESHQKEDEIVSQPSS EPFVAESEVSKVEQEETNPEVLIKDLQDVASHESGVSDQPAQVVTERESEIESHQGETEK ESGITESHQKEDEIVSQPSSEPFVAESEVSKVEQEKTNPEILVEDLPLGQVIPVVVEKDE MFAPSFNPIVIKEEDKVCETCEQEFEIVKDSQTVKGSEDIISPMQCLESMDSIVSTIFES GMLCPMSKPGQYVCGYEMYMYGFQDVKDLLGGLLSNVPVCCNVSLYFMEHNYFTNHENIN HNVVNDIV
Sequence length 548 AA
Subcellular LocationSurface
Function Immunodominant surface protein.
Glycosylation Status
Glycosylation Type Information currently not available with us.
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionGlycoprotein detection kit using periodate.
Literature
Year of Identification2000
Year of Identification Month Wise2000.01
Reference1) McBride, J.W., Yu, X.J. and Walker, D.H. (2000) Glycosylation of homologous immunodominant proteins of Ehrlichia chaffeensis and Ehrlichia canis. Infect Immun, 68, 13-18. [PubMed: 10603362]
Author Walker, D.H.
Research GroupDepartment of Pathology and WHO Collaborating Center for Tropical Diseases, University of Texas Medical Branch, Galveston, Texas 
Corresponding Author McBride, J.W., Yu, X.J. Walker, D.H.
ContactDepartment of Pathology and WHO Collaborating Center for Tropical Diseases, University of Texas Medical Branch, Galveston, Texas