ProGP184

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP184
Validation Status Uncharacterized
Organism Information
Organism NameMycobacterium tuberculosis
Domain Bacteria
Classification Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 1773
Genome Sequence(s)
GenBank BX842573.1
EMBL BX842573
Organism Additional Information It is the causative agent of human tuberculosis. The pathogenesis is influenced by its lipoglycans and glycolipids (having a wide range of immunomodulatory activities), and a variety of its virulence factors and antigens.
Gene Information
Gene NameglnH (Rv0411c)
NCBI Gene ID 886393
Protein Information
Protein NameGlnH
UniProtKB/SwissProt ID P96257
NCBI RefSeq NP_214925.1
EMBL-CDSCAB06581.1
UniProtKB Sequence >tr|P96257|P96257_MYCTU Amino acid ABC transporter, amino acid-binding protein OS=Mycobacterium tuberculosis GN=glnH PE=4 SV=1 MTRRALLARAAAPLAPLALAMVLASCGHSETLGVEATPTLPLPTPVGMEIMPPQPPLPPD SSSQDCDPTASLRPFATKAEADAAVADIRARGRLIVGLDIGSNLFSFRDPITGEITGFDV DIAGEVARDIFGVPSHVEYRILSAAERVTALQKSQVDIVVKTMSITCERRKLVNFSTVYL DANQRILAPRDSPITKVSDLSGKRVCVARGTTSLRRIREIAPPPVIVSVVNWADCLVALQ QREIDAVSTDDTILAGLVEEDPYLHIVGPDMADQPYGVGINLDNTGLVRFVNGTLERIRN DGTWNTLYRKWLTVLGPAPAPPTPRYVD
Sequence length 328 AA
Function Glutamine-binding lipoprotein.
Glycosylation Status
Glycosylation Type Information currently not available with us.
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionConcanavalin A (ConA) binding
Literature
Year of Identification2000
Year of Identification Month Wise2000.02
Reference1) Gonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C. (2009) Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins. J Proteome Res, 8, 721-733. [PubMed: 19196185]
AuthorGonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C
Research GroupDepartamento de Inmunologia, Instituto de Investigaciones Biomedicas, Universidad Nacional Autonoma de Mexico, Mexico.
Corresponding Author Espitia, C
ContactDepartamento de Inmunologia, Instituto de Investigaciones Biomedicas, Universidad Nacional Autonoma de Mexico, Mexico.
ReferenceHerrmann, J.L., Delahay, R., Gallagher, A., Robertson, B. and Young, D. (2000) Analysis of post-translational modification of mycobacterial proteins using a cassette expression system. FEBS Lett, 473, 358-362. [PubMed: 10818240]
AuthorHerrmann, J.L., Delahay, R., Gallagher, A., Robertson, B. Young, D.
Research GroupDepartment of Infectious Diseases and Microbiology, Imperial College School of Medicine, St. Mary's Campus, Norfolk Place, W2 1PG, London, UK
Corresponding Author Young, D.
ContactDepartment of Infectious Diseases and Microbiology, Imperial College School of Medicine, St. Mary's Campus, Norfolk Place, W2 1PG, London, UK