ProGP190 (LppN lipoprotein)

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP190 (LppN lipoprotein)
Validation Status Uncharacterized
Organism Information
Organism NameMycobacterium tuberculosis H37Rv
Domain Bacteria
Classification Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 1773
Genome Information
GenBank BX842579.1
EMBL BX842579
Organism Additional Information It is the causative agent of human tuberculosis. The pathogenesis is influenced by its lipoglycans and glycolipids (having a wide range of immunomodulatory activities), and a variety of its virulence factors and antigens.
Gene Information
Gene NamelppN (Rv2270)
NCBI Gene ID 887448
GenBank Gene Sequence NC_000962
Protein Information
Protein NameLppN lipoprotein
UniProtKB/SwissProt ID P9WK73
NCBI RefSeq NP_216786.1
EMBL-CDSCAB00965.1
UniProtKB Sequence >sp|P9WK72|LPPN_MYCTO Putative lipoprotein LppN OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=lppN PE=3 SV=1 MRLPGRHVLYALSAVTMLAACSSNGARGGIASTNMNPTNPPATAETATVSPTPAPQSART ETWINLQVGDCLADLPPADLSRITVTIVDCATAHSAEVYLRAPVAVDAAVVSMANRDCAA GFAPYTGQSVDTSPYSVAYLIDSHQDRTGADPTPSTVICLLQPANGQLLTGSARR
Sequence length 175 AA
Function Lipoprotein
Glycosylation Status
Technique(s) used for Glycosylation DetectionConcanavalin A (ConA) binding
Literature
Year of Identification2000
Year of Identification Month Wise2000.05
ReferenceHerrmann, J.L., Delahay, R., Gallagher, A., Robertson, B. and Young, D. (2000) Analysis of post-translational modification of mycobacterial proteins using a cassette expression system. FEBS Lett, 473, 358-362. [PubMed: 10818240]
Author Young, D.
Research GroupDepartment of Infectious Diseases and Microbiology, Imperial College School of Medicine, St. Marys Campus, Norfolk Place, W2 1PG, London
Corresponding Author Herrmann, J.L., Delahay, R., Gallagher, A., Robertson, B. Young, D.
ContactDepartment of Infectious Diseases and Microbiology, Imperial College School of Medicine, St. Marys Campus, Norfolk Place, W2 1PG, London