ProGP192

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP192
Validation Status Uncharacterized
Organism Information
Organism NameMycobacterium tuberculosis
Domain Bacteria
Classification Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 1773
Genome Sequence(s)
GenBank BX842579.1
EMBL BX842579
Organism Additional Information It is the causative agent of human tuberculosis. The pathogenesis is influenced by its lipoglycans and glycolipids (having a wide range of immunomodulatory activities), and a variety of its virulence factors and antigens.
Gene Information
Gene NamelppQ (Rv2341)
NCBI Gene ID 886275
Protein Information
Protein NameLppQ lipoprotein
UniProtKB/SwissProt ID P95237
NCBI RefSeq NP_216857.1
EMBL-CDSCAB06158.1
UniProtKB Sequence >tr|P95237|P95237_MYCTU Lipoprotein, putative OS=Mycobacterium tuberculosis GN=lppQ PE=4 SV=1 MPVGGRQHVFEKLASILGLVAAPLMLLGLSACGRSAGKTSEPTCPTEPIDAADSSTTPDP SCVVRATEINGNGSRIQTWTGSYDAAATQSGGVCGGTCNFHATVRFTVDEGQISGSVDQV YQAAMVAIATRPTSPSLAP
Sequence length 139 AA
Function Lipoprotein
Glycosylation Status
Technique(s) used for Glycosylation DetectionConcanavalin A (ConA) binding
Literature
Year of Identification2000
Year of Identification Month Wise2000.05
ReferenceHerrmann, J.L., Delahay, R., Gallagher, A., Robertson, B. and Young, D. (2000) Analysis of post-translational modification of mycobacterial proteins using a cassette expression system. FEBS Lett, 473, 358-362. [PubMed: 10818240]
Author Young, D.
Research GroupDepartment of Infectious Diseases and Microbiology, Imperial College School of Medicine, St. Marys Campus, Norfolk Place, W2 1PG, London
Corresponding Author Herrmann, J.L., Delahay, R., Gallagher, A., Robertson, B. Young, D.
ContactDepartment of Infectious Diseases and Microbiology, Imperial College School of Medicine, St. Marys Campus, Norfolk Place, W2 1PG, London