ProGP194

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP194
Validation Status Uncharacterized
Organism Information
Organism NameMycobacterium tuberculosis
Domain Bacteria
Classification Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 1773
Genome Sequence(s)
GenBank BX842575.1
EMBL BX842575
Organism Additional Information It is the causative agent of human tuberculosis. The pathogenesis is influenced by its lipoglycans and glycolipids (having a wide range of immunomodulatory activities), and a variety of its virulence factors and antigens.
Gene Information
Gene NamepstS1 (Rv0934)
NCBI Gene ID 885724
Protein Information
Protein NamePstS1
UniProtKB/SwissProt ID P9WGU1
NCBI RefSeq WP_003900236.1
EMBL-CDSAAA25374.1
UniProtKB Sequence >sp|P9WGU1|PSTS1_MYCTU Phosphate-binding protein PstS 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pstS1 PE=1 SV=1 MKIRLHTLLAVLTAAPLLLAAAGCGSKPPSGSPETGAGAGTVATTPASSPVTLAETGSTL LYPLFNLWGPAFHERYPNVTITAQGTGSGAGIAQAAAGTVNIGASDAYLSEGDMAAHKGL MNIALAISAQQVNYNLPGVSEHLKLNGKVLAAMYQGTIKTWDDPQIAALNPGVNLPGTAV VPLHRSDGSGDTFLFTQYLSKQDPEGWGKSPGFGTTVDFPAVPGALGENGNGGMVTGCAE TPGCVAYIGISFLDQASQRGLGEAQLGNSSGNFLLPDAQSIQAAAAGFASKTPANQAISM IDGPAPDGYPIINYEYAIVNNRQKDAATAQTLQAFLHWAITDGNKASFLDQVHFQPLPPA VVKLSDALIATISS
Sequence length 374 AA
Subcellular LocationMembrane
Function Periplasmic phosphate-binding lipoprotein PSTS1 (PBP-1) (PSTS1); part of the ABC transporter complex pstSACB involved in phosphate import. 38 kDa antigen.
Glycosylation Status
Technique(s) used for Glycosylation DetectionConcanavalin A (ConA) binding
Literature
Year of Identification2000
Year of Identification Month Wise2000.05
ReferenceGonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C. (2009) Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins. J Proteome Res, 8, 721-733. [PubMed: 19196185]
AuthorGonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C
Research GroupDepartment of Immunology, Institute of Biomedical Research, National Autonomous University of Mexico, Mexico.
Corresponding Author Espitia, C
ContactDepartment of Immunology, Institute of Biomedical Research, National Autonomous University of Mexico, Mexico.
ReferenceHerrmann, J.L., Delahay, R., Gallagher, A., Robertson, B. and Young, D. (2000) Analysis of post-translational modification of mycobacterial proteins using a cassette expression system. FEBS Lett, 473, 358-362. [PubMed: 10818240]
AuthorHerrmann, J.L., Delahay, R., Gallagher, A., Robertson, B. Young, D.
Research GroupDepartment of Infectious Diseases and Microbiology, Imperial College School of Medicine, St. Marys Campus, Norfolk Place, W2 1PG, London, UK
Corresponding Author Young, D.
ContactDepartment of Infectious Diseases and Microbiology, Imperial College School of Medicine, St. Marys Campus, Norfolk Place, W2 1PG, London, UK