ProGP196

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP196
Validation Status Uncharacterized
Organism Information
Organism NameStreptococcus pyogenes type M5 (Manfredo strain)
Domain Bacteria
Classification Family: Streptococcaceae
Order: Lactobacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI) 160491
Genome Sequence(s)
GenBank AM295007.1
EMBL AM295007
Gene Information
Gene NamesagP or arcA (SpyM50577)
NCBI Gene ID 4964002
Protein Information
Protein NameStreptococcal acid glycoprotein SAGP
UniProtKB/SwissProt ID P58827
NCBI RefSeq YP_001128150.1
EMBL-CDSCAM29914.1
UniProtKB Sequence >sp|P58827|ARCA_STRPG Arginine deiminase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=arcA PE=1 SV=3 MTAQTPIHVYSEIGKLKKVLLHRPGKEIENLMPDYLERLLFDDIPFLEDAQKEHDAFAQA LRDEGIEVLYLETLAAESLVTPEIREAFIDEYLSEANIRGRATKKAIRELLMAIEDNQEL IEKTMAGVQKSELPEIPASEKGLTDLVESNYPFAIDPMPNLYFTRDPFATIGTGVSLNHM FSETRNRETLYGKYIFTHHPIYGGGKVPMVYDRNETTRIEGGDELVLSKDVLAVGISQRT DAASIEKLLVNIFKQNLGFKKVLAFEFANNRKFMHLDTVFTMVDYDKFTIHPEIEGDLRV YSVTYDNEELHIIEEKGDLAELLAANLGVEKVDLIRCGGDNLVAAGREQWNDGSNTLTIA PGVVVVYNRNTITNAILESKGLKLIKIHGSELVRGRGGPRCMSMPFEREDI
Sequence length 411 AA
Subcellular LocationIntracellular
Function SAGP,or its homolog,possesses AD (L-arginine deiminase) activity. The potent inhibition of proliferation of human T-cells by streptococcal CE is due to activity of this enzyme.
Literature
Year of Identification2000
Year of Identification Month Wise2000.06
ReferenceDegnan, B.A., Fontaine, M.C., Doebereiner, A.H., Lee, J.J., Mastroeni, P., Dougan, G., Goodacre, J.A. and Kehoe, M.A. (2000) Characterization of an isogenic mutant of Streptococcus pyogenes Manfredo lacking the ability to make streptococcal acid glycoprotein. Infect Immun, 68, 2441-2448. [PubMed: 10768929]
AuthorDegnan BA, Fontaine MC, Doebereiner AH, Lee JJ, Mastroeni P, Dougan G, Goodacre JA, Kehoe MA.
Research GroupSchool of Clinical Medical Sciences (Rheumatology), Medical School, University of Newcastle, Newcastle upon Tyne NE2 4HH, United Kingdom.
Corresponding Author Kehoe MA.
ContactSchool of Clinical Medical Sciences (Rheumatology), Medical School, University of Newcastle, Newcastle upon Tyne NE2 4HH, United Kingdom.
ReferenceDegnan, B.A., Palmer, J.M., Robson, T., Jones, C.E., Fischer, M., Glanville, M., Mellor, G.D., Diamond, A.G., Kehoe, M.A. and Goodacre, J.A. (1998) Inhibition of human peripheral blood mononuclear cell proliferation by Streptococcus pyogenes cell extract is associated with arginine deiminase activity. Infect Immun, 66, 3050-3058. [PubMed: 9632565]
AuthorDegnan, B.A., Palmer, J.M., Robson, T., Jones, C.E., Fischer, M., Glanville, M., Mellor, G.D., Diamond, A.G., Kehoe, M.A. Goodacre, J.A.
Research GroupSchool of Clinical Medical Sciences (Rheumatology), Immunological and Virological Sciences, The Medical School, University of Newcastle upon Tyne, Newcastle upon Tyne, NE2 4HH, United Kingdom
Corresponding Author Goodacre, J.A.
ContactSchool of Clinical Medical Sciences (Rheumatology), Immunological and Virological Sciences, The Medical School, University of Newcastle upon Tyne, Newcastle upon Tyne, NE2 4HH, United Kingdom