ProGP198

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP198
Validation Status Characterized
Organism Information
Organism NameBacillus lentus
Domain Bacteria
Classification Family: Bacillaceae
Order: Bacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI) 1467
Protein Information
Protein NameSubtilisin (SBL)- Cys mutant
UniProtKB/SwissProt ID  P29600
UniProtKB Sequence >sp|P29600|SUBS_BACLE Subtilisin Savinase OS=Bacillus lentus PE=1 SV=1 AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGN GHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVA NLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNR ASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQI RNHLKNTATSLGSTNLYGSGLVNAEAATR
Sequence length 269 AA
Subcellular LocationSecreted
Function Subtilisin is an extracellular alkaline serine protease. EC = 3.4.21.62
Protein Structure
PDB ID 1JEA
Glycosylation Status
Glycosylation Type S- (Cys) linked
Experimentally Validated Glycosite(s) in Full Length ProteinN62C, S156C, S166C and L217C (Residues that are shown glycosylated in vitro upon mutation from, N, S and L to C respectively)
Experimentally Validated Glycosite(s ) in Mature ProteinN62C, S156C, S166C and L217C (Residues that are shown glycosylated in vitro upon mutation from, N, S and L to C respectively)
Glycosite(s) Annotated Protein Sequence >1JEA:A|PDBID|CHAIN|SEQUENCE AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVL GVAPSAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSIS YPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQI RNHLKNTATSLGSTNLYGSGLVNAEAATR
This sequence was mutated at four residues to cysteines which were then glycosylated: >1JEA:A|PDBID|CHAIN|SEQUENCE AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGC*(62)GHGTHVAGTIAALNNSIGVL GVAPSAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNC*(156)GAGSIC*(166) YPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASC*(217)NGTSMATPHVAGAAALVKQKNPSWSNVQI RNHLKNTATSLGSTNLYGSGLVNAEAATR
Sequence Around Glycosites (21 AA) VPGEPSTQDGCGHGTHVAGTI
GVLVVAASGNCGAGSISYPAR
ASGNSGAGSICYPARYANAMA
STYPGSTYASCNGTSMATPHV
Technique(s) used for Glycosylation DetectionIn vitro chemical glycosylation
Technique(s) used for Glycosylated Residue(s) Detection Not applicable
Protein Glycosylation- Implication In vitro engineered glycosylations of native subtilisin has been shown to affect structure as well as enzymatic activity.
Glycan Information
Glycan Annotation L217C-S-β-Glc(Ac)2, L217C-S-β-Glc(Ac)3, N62C-S-β-Glc(Ac)4, S156C-S-β-Glc(Ac)4, S16C-S-β-Glc(Ac)4.
Technique(s) used for Glycan Identification Acetylated glycans were predetermined and synthesized in vitro
Literature
Year of Identification2000
Year of Identification Month Wise2000.09.10
Year of Validation 2000
ReferenceDavis, B.G., Lloyd, R.C. and Jones, J.B. (2000) Controlled site-selective protein glycosylation for precise glycan structure-catalytic activity relationships. Bioorg Med Chem, 8, 1527-1535. [PubMed: 10976501]
AuthorDavis, B.G., Lloyd, R.C. and Jones, J.B.
Research GroupDepartment of Chemistry, University of Durham, UK
Corresponding Author Jones, J.B
ContactDepartment of Chemistry, University of Durham, UK
Reference Lloyd, R.C. Davis, B.G. and Jones, J.B. (2000) Site-selective glycosylation of subtilisin Bacillus lentus causes dramatic increases in esterase activity. Bioorg Med Chem, 8, 1537-44. [PubMed: 10976502]
Author Lloyd, R.C. Davis, B.G. and Jones, J.B
Research GroupDepartment of Chemistry, University of Toronto, ON, Canada.
Corresponding Author Jones, J.B.
ContactDepartment of Chemistry, University of Toronto, ON, Canada.
Reference Lloyd, R.C. Davis, B.G. and Jones, J.B. (2000) Site-selective glycosylation of subtilisin Bacillus lentus causes dramatic increases in esterase activity. Bioorg Med Chem, 8, 1537-44. [PubMed: 10976502]
Author Lloyd, R.C. Davis, B.G. Jones, J.B.
Research GroupDepartment of Chemistry, University of Toronto, ON, Canada.
Corresponding Author Jones, J.B.
ContactDepartment of Chemistry, University of Toronto, ON, Canada.
Reference Graycar, T., Knapp, M., Ganshaw, G., Dauberman, J. and Bott, R. (1999) Engineered Bacillus lentus subtilisins having altered flexibility. J Mol Biol, 292, 97-109. [PubMed: 10493860]
Author Graycar, T., Knapp, M., Ganshaw, G., Dauberman, J. Bott, R.
Research GroupGenencor International, 925 Page Mill Road, Palo Alto, CA 94304, USA.
Corresponding Author Bott, R.
ContactGenencor International, 925 Page Mill Road, Palo Alto, CA 94304, USA.