ProGP203

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP203
Validation Status Uncharacterized
Organism Information
Organism NameThermococcus litoralis DSM 5473
Domain Archaea
Classification Family: Thermococcaceae
Order: Thermococcales
Class: Thermococci or Protoarchaea
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI) 2265
Genome Sequence(s)
EMBL AF012836
Gene Information
Gene NamemalE
Protein Information
Protein NameTMBP (Trehalose/maltose binding protein)
UniProtKB/SwissProt ID Q7LYW7
EMBL-CDSAAC38136.1
UniProtKB Sequence >tr|Q7LYW7|Q7LYW7_THELI Trehalose/maltose binding protein OS=Thermococcus litoralis GN=malE PE=4 SV=1 MNVKKVLLGLFLVGVLGIAVVASGCIGGQQTSTVTSTPTETSLQGKIVFAVGGAPNEIEY WKGVIAEFEKKYPGVTVELKRQATDTEQRRLDLVNALRGKSSDPDVFLMDVAWLGQFIAS GWLEPLDDYVQKDNYDLSVFFQSVINLADKQGGKLYALPVYIDAGLLYYRKDLLEKYGYS KPPETWQELVEMAQKIQSGERETNPNFWGFVWQGKQYEGLVCDFVEYVYSNGGSLGEFKD GKWVPTLNKPENVEALQFMVDLIHKYKISPPNTYTEMTEEPVRLMFQQGNAAFERNWPYA WGLHNADDSPVKGKVGVAPLPHFPGHKSAATLGGWHIGISKYSDNKALAWEFVKFVESYS VQKGFAMNLGWNPGRVDVYDDPAVVSKSPHLKELRAVFENAVPRPIVPYYPQLSEIIQKY VNSALAGKISPQEALDKAQKEAEELVKQYS
Sequence length 450 AA
Subcellular LocationMembrane associated
Function This soluble protein is involved in ABC transport of trehalose and maltose. It has got an exceptionally high substrate-binding affinity and transports the substrates at 85 deg C.
Glycosylation Status
Glycosylation Type Information currently not available with us.
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionPAS-staining and ConA-Sepharose affinity chromatography.
Literature
Year of Identification2001
Year of Identification Month Wise2001.7
Reference1) Greller, G., Riek, R. and Boos, W. (2001) Purification and characterization of the heterologously expressed trehalose/maltose ABC transporter complex of the hyperthermophilic archaeon Thermococcus litoralis. Eur J Biochem, 268, 4011-4018. [PubMed: 11453995]
Author Greller, G., Riek, R. Boos, W.
Research GroupDepartment of Biology, University of Konstanz, Germany
Corresponding Author Boos, W.
ContactDepartment of Biology, University of Konstanz, Germany