ProGP204

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP204
Validation Status Uncharacterized
Organism Information
Organism NameStreptomyces coelicolor A3(2)
Domain Bacteria
Classification Family: Streptomycetaceae
Suborder: Streptomycineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 100226
Genome Sequence(s)
GenBank NC_003888.3
EMBL AL939115
Protein Information
Protein NameCell envelope glycoprotein
UniProtKB/SwissProt ID Q8KVT6
EMBL-CDSAAM78434.1
UniProtKB Sequence >tr|Q8KVT6|Q8KVT6_STRCO Putative secreted protein (Fragment) OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=ecrD PE=4 SV=1 TGILSLCGSPALADSHADGAATNSPGAVSGNALQVPVDVPVNACGNTVDVIAALNPAFGN ECENASDEKTDGHGGGYGEDASSSSSSSTSASSSGSHADGATEGSPGVGSGNNAQVPVDV PVNLCGNTVDVIAALNPVFGNKCENDAEEPPGYGEEEPPPPTTPPGYGEEEPPPPTHEEP PPPSGEEEPPPPSEEEHTPPAPQTEQPPALAETGSEGTLGAAAAGAVLIAGGAILYRRGR
Sequence length 240 AA
Subcellular LocationCell wall associated
Function It acts as a phage receptor for (phi)C31.
Glycosylation Status
Glycosylation Type O- (Ser/Thr) linked
Technique(s) used for Glycosylation DetectionConcanavalin A-binding
Literature
Year of Identification2001
Year of Identification Month Wise2001.7
ReferenceCowlishaw, D.A. and Smith, M.C. (2002) A gene encoding a homologue of dolichol phosphate-beta-D-mannose synthase is required for infection of Streptomyces coelicolor A3(2) by phage (phi)C31. J Bacteriol, 184, 6081-6083. [PubMed: 12374845]
AuthorCowlishaw DA1, Smith MC
Research GroupInstitute of Genetics, University of Nottingham, Queens Medical Centre, Nottingham NG7 2UH, United Kingdom.
Corresponding Author Smith MC
ContactInstitute of Genetics, University of Nottingham, Queens Medical Centre, Nottingham NG7 2UH, United Kingdom.
ReferenceCowlishaw, D.A. and Smith, M.C. (2001) Glycosylation of a Streptomyces coelicolor A3(2) cell envelope protein is required for infection by bacteriophage phi C31. Mol Microbiol, 41, 601-610. [PubMed: 11532128]
AuthorCowlishaw, D.A. Smith, M.C.
Research GroupGraduate School of Biological Sciences, Nara Institute of Science and Technology, 8916-5, Takayama Ikoma, Nara 630-0101, Japan. 
Corresponding Author Smith, M.C.
ContactGraduate School of Biological Sciences, Nara Institute of Science and Technology, 8916-5, Takayama Ikoma, Nara 630-0101, Japan.