ProGP209

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP209
Validation Status Uncharacterized
Organism Information
Organism NameGeobacillus (formerly Bacillus) stearothermophilus ATCC 12980/G+
Domain Bacteria
Classification Family: Bacillaceae
Order: Bacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI) 1422
Genome Sequence(s)
EMBL AF228338
Gene Information
Gene NamesbsD
Protein Information
Protein NameSbsD (S-layer glycoprotein)
UniProtKB/SwissProt ID Q9KIQ5
EMBL-CDSAAF34763.2
UniProtKB Sequence >tr|Q9KIQ5|Q9KIQ5_GEOSE SbsD OS=Geobacillus stearothermophilus GN=sbsD PE=4 SV=1 MDKKKAVKLATASAVAASAFVAANPHASQAATDVATVVSQAKAQMKEAYYTYSHTVTETG KLPNISDVYAAYNKAKQAYANAVAVVNKAGGAKKDAYLADLQATYETYVFKANPKSGEAR VATYIDAYNYATKLDAMRQELKAAVEAKDLKKAEELYHKISYELKTRTVILDRVYGQSTR ELLRSTFKADAQALRDSLIYDITVAMKAREAQDAAKAGNLDKAKAALDQVNQYVSKVTDA FKAELQKAAQDANAAYEAALPPKVESVTAVNAKTLEIKFNKAVDVATVIDNKGTSDTSDD VVKATAITLTAIDGQGSVSTVKASLSDDKKTLKLVADGSQFFTKRYVVDIKNVKTLDGKD VPSYTTTIDTTDSVRPSVLSSSYADNGLTLKVKFSEPLASVGTVKLYDGTTEISVSPKFT AGDDEMTINLASSSVPVNKDLTLKIFGAVDYNGNVINPNPAELTVKKTTVDTTKPTVQNI EAVNTKTVKVTFSEKLLSNPTIKIGGQTASVSVDSTGLVYTATLANALSEGVYAVEVSDY KDLAGNAGDTYTKVVQLKADTTAPKFVSSQVVKIDGVEHLVLTFDEEVTTGSNITVVQAS DKYVDENNVLKSVGTTLTTTSDNFKLYLPTDGKSKSVALNISSLPKGTYTVTLPDRLVSD LAGNPYAERKQITFVRGSDSLTTKPALDSSYDNNGVKADNNNELVFAFTQNLDASALNLS NFNINGLAVTKAVFDGDTKHIRVTLAPGANTWTGTHVITISNIKNTSGLVMDTVTVSEFM KENVAPTFTATLTSADVIRVDFSEPVANATISSPLSANNFTVKVDGNVVTVSNVYEDNNA TNQVQGSTGYKTVYLKLQSPVSDLSKPITLSATGIVDVDQTGAITNNNLVGNNVSNAVVN VAK
Sequence length 903 AA
Subcellular LocationSurface
Function Biosynthesis of S-layer glycoprotein occurs due to S-layer variation at higher temperature.
Glycosylation Status
Glycosylation Type O(Ser/Thr)- linked
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionPeriodate-Schiff (PAS) reagent staining, deglycosylation with trifluoromethanesulfonic acid
Glycan Information
Glycan Annotation Contains mannose, glucose, galactose and rhamnose as revealed by neutral sugar and amino sugar analysis. These sugars are present in a molar ratio of 1.85, 1, 1.02 and 0.78, respectively. Glycan chains are bound via O-linkage to serine or threonine residues.
Literature
Year of Identification2001
Year of Identification Month Wise2001.12
Reference1) Egelseer, E.M., Danhorn, T., Pleschberger, M., Hotzy, C., Sleytr, U.B. and Sara, M. (2001) Characterization of an S-layer glycoprotein produced in the course of S-layer variation of Bacillus stearothermophilus ATCC 12980 and sequencing and cloning of the sbsD gene encoding the protein moiety. Arch Microbiol, 177, 70-80. [PubMed: 11797047]
Author Sara, M.
Research Group Center for Ultrastructure Research, Ludwig Boltzmann-Institute for Molecular Nanotechnology, University of Agricultural Sciences, 1180 Vienna, Austria.
Corresponding Author Egelseer, E.M., Danhorn, T., Pleschberger, M., Hotzy, C., Sleytr, U.B. Sara, M.