ProGP210

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP210
Validation Status Uncharacterized
Organism Information
Organism NameStreptococcus parasanguis FW213
Domain Bacteria
Classification Family: Streptococcaceae
Order: Lactobacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI) 1318
Genome Sequence(s)
GenBank AF100426
EMBL AF100426
Gene Information
Gene Namefap1
Protein Information
Protein NameFap1 (Fimbrial adhesin)
UniProtKB/SwissProt ID Q9ZFF9
EMBL-CDSAAC79868.1
UniProtKB Sequence >tr|Q9ZFF9|Q9ZFF9_STRPA Fimbriae-associated protein Fap1 OS=Streptococcus parasanguis GN=fap1 PE=1 SV=1 MHKSGKNWVRTLISQIGLMHFLGGSISEKKINVDVYEQKNISASTILKGAVALGALTGAT VVSGNVFADETVLAKETTLTTTDANEVKLSSENFDSEKAEEKISLSQSESASESVSESIS ESVSESVSTSESVSESVSESVSESISESVSESISESISESVSESTSTSIVLSESGAASGN KATSKGTEEKQDSVRENLDKMISEAEVLNDMAARKLITLDAEQQLELMKSLVATQSQLEA TKNLIGDPNATVADLQIAYTTLGNNTQALGNELIKLNPNGQIYAVLNNTEASRAATLRST TTGTKTTFTISDFSNGGTQYYWAGGNANNLKNPISSISAVYDSATGKISWTVEYDPTTIL KSPALKTLKTYTGIYIDTSSDSKLSTPTNVLIDGAATNPVTNFYGNGSKGIEYVSKGTTK GVTKHTITFDTAFSGRANDLADLEIKMLAATTLSDPHFYEDGSKGNYGRYNGQTAPYVIA NDSGTAIGGYQVSGVNADSIPSDTTSQSESASKSESTSKSISESVIESISESVIGSVSES VSESVSESVSESITESVSESVSESISESVSESVSESISESVSESVSESISESVSESVSES ISESVSESVSESISESISESVSESVSESISESVSESVSESISESVSESVSESISESVSES VSESISESVSESVSESISESVSESVSESIXESVSESVSESISESVSESVSESISESVSES VSESISESVSESVSESISESVSESVSESISESVSESVSESVSESVSESVSESISESVSES VSESVSESVSESVSESVSESISESVSESVSESISESVSESVSESISESVSESVSESISES VSESVSESISESVSESVSESISESVSESVSESISESVSESVSESISESVSESVSESISES VSESVSESISESVSESVSESVSESVSESVSESVSESVSESISESVSESVSESISESVSES VSESISESVSESVSESISESVSESVSESISESVSESVSESVSESVSESVSESVSESVSES ISESVSESVSESVSESISESVSESVSESISESVSESVSESISESVSESVSESVSESVSES VSESISESVSESVSESISESVSESVSESISESVSESVSESISESVSESPSESISESVSES VSESISESVSESVSESVSESVSESVSESISESVSESVSESISESVSESVSESVSESISES VSESVSESSSESVSESVSESISESVSESVSESISESVSESVSESVSESVSESVSESVSES VSESVSESVSESISESVSESVSESVSESISESVSESVSESISESVSESVSESISESVSES VSESISESVSESVSESISESVSESVSESISESVSESVSESVSESVSESVSESISESVSES VSESISESVSESVSESISESVSESVSESISESVSESVSESVSESISESVSESVSESISES VSESVSESISESVSESVSESVSESVSESVSESVSESVSESVSESISESVSESVSESISES VSESVSESISESVSESVSESISESVSESVSESISESVSESVSESISESVSESVSESISES VSESVSESVSESVSESVSESISESVSESVSESISESVSESVSESVSESVSESVSESVSES VSESVSESISESVSESVSESVSESVSESVSESISESVSESVSESISESVSESVSESISES VSESVSESISESVSESVSESISESVSESVSESISESVSESVSESISESVSESVSESVSES VSESVSESVSESVSESISESVSESVSESISESVSESVSESISESVSESVSESVSESVSES VSESISESVSESMSESISESVSESVSESISESVSESVSESISEPVSESVSESVSESISES VSESVSETISESVSESVSESISESVSESVSESISESVSESVSESISESVSESVSESISES VSESVSESVSESVSESVSESISESVSESISESVSESVSESISESVSESVSESISESVSES VSESISESVSESVSESISESVSESVSESISESVSESVSESISESVSESVSESISESVSES VSESVSESISESVSESVSESISESVSESVSESISESVSESVSESVSESVSESVSESVSES VSESVSESISESVSESVSESISESVSESVSESISESVSESVSESISESVSESVSESISES VSESVSESISESVSESVSESISESVSESVSESVSESVSESVSESISESVSESVSESVSES ISESVSESVSESISESVSESVSESVSESVSESVSESVSESVSESVSESISESVSESVSES VSESVSESVSESISESVSESVSESISESVSESVSESISESVSESVSESISESVSESVSES ISESVSESVSESISESVSESVSESISESVSESVSESISESVSESVSESVSESISESVSES VSESISESVSESVSESISESVSESVSESISESVSESVSESVSESVSESVSESVSESVSES ISESVSESVSESISESVSESVSESVSESVSESVSESISESVSESISESVSESVSESISES VSESVSESISERTLPNTGENVSSSLGLVGLSGLLFGALLGRKKRKSEDAE
Sequence length 2570 AA
Subcellular LocationSecreted
Function The Fap1 adhesin protein (identified as the major fimbrial subunit) is essential for fimbrial biogenesis.
Protein Structure
PDB ID 2KUB, 2X12
Glycosylation Status
Technique(s) used for Glycosylation DetectionPeriodic acid-Schiff (PAS) staining
Glycan Information
Glycan Annotation Monosaccharide composition detected by gas-liquid chromatography revealed the presence of several different isomers of glucose, galactose, N-acetylglucosamine, N-acetylgalactosamine, and rhamnose at a ratio of 29:5:39:1:1.
Protein Glycosylation linked (PGL) gene(s)
OST ProGT IDProGT26,ProGT27,ProGT40,ProGT41,ProGT42,ProGT77,ProGT118,ProGT119
Literature
Year of Identification2002
Year of Identification Month Wise2002.1
ReferenceStephenson, A.E., Wu, H., Novak, J., Tomana, M., Mintz, K. and Fives-Taylor, P. (2002) The Fap1 fimbrial adhesin is a glycoprotein: antibodies specific for the glycan moiety block the adhesion of Streptococcus parasanguis in an in vitro tooth model. Mol Microbiol, 43, 147-157. [PubMed: 11849543]
Author Stephenson, A.E., Wu, H., Novak, J., Tomana, M., Mintz, K. Fives-Taylor, P.
Research GroupDepartment of Microbiology, University of Vermont, Burlington, VT, USA.
Corresponding Author Fives-Taylor, P.
ContactDepartment of Microbiology, University of Vermont, Burlington, VT, USA.