ProGP211 (TMBP (Trehalose/maltose binding protein)

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP211 (TMBP (Trehalose/maltose binding protein)
Validation Status Uncharacterized
Organism Information
Organism NamePyrococcus furiosus DSM 3638
Domain Archaea
Classification Family: Thermococcaceae
Order: Thermococcales
Class: Thermococci or Protoarchaea
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI) 2261
Genome Information
GenBank AE009950.1
EMBL AE009950
Gene Information
Gene NamemalE (PF1739)
NCBI Gene ID 1469617
GenBank Gene Sequence NC_003413
Protein Information
Protein NameTMBP (Trehalose/maltose binding protein)
UniProtKB/SwissProt ID O51923
NCBI RefSeq NP_579468.1
EMBL-CDSAAL81863.1
UniProtKB Sequence >tr|O51923|O51923_PYRFU Trehalose/maltose binding protein OS=Pyrococcus furiosus GN=malE PE=1 SV=1 MNVKKVLLGLFLVGVLGIAVVASGCIGGQQTSTVTSTPTETSLQGKIVFAVGGAPNEIEY WKGVIAEFEKKYPGVTVELKRQATDTEQRRLDLVNALRGKSSDPDVFLMDVAWLGQFIAS GWLEPLDDYVQKDNYDLSVFFQSVINLADKQGGKLYALPVYIDAGLLYYRKDLLEKYGYS KPPETWQELVEMAQKIQSGERETNPNFWGFVWQGKQYEGLVCDFVEYVYSNGGSLGEFKD GKWVPTLNKPENVEALQFMVDLIHKYKISPPNTYTEMTEEPVRLMFQQGNAAFERNWPYA WGLHNADDSPVKGKVGVAPLPHFPGHKSAATLGGWHIGISKYSDNKALAWEFVKFVESYS VQKGFAMNLGWNPGRVDVYDDPAVVSKSPHLKELRAVFENAVPRPIVPYYPQLSEIIQKY VNSALAGKISPQEALDKAQKEAEELVKQYS
Sequence length 450 AA
Subcellular LocationMembrane
Function Binding protein-dependent ABC transporter mediating uptake of ?-glucosides. It transports trehalose and maltose.
Protein Structure
PDB ID 1EUB
Glycosylation Status
Glycosylation Type N- (Asn) linked
Technique(s) used for Glycosylation DetectionConcanavalin A (ConA) binding, Periodic acid- Schiff reagent (PAS) staining.
Glycan Information
Glycan Annotation Glucose moieties.
Literature
Year of Identification2002
Year of Identification Month Wise2002.4