ProGP212

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP212
Validation Status Uncharacterized
Organism Information
Organism NamePyrococcus furiosus DSM 3638
Domain Archaea
Classification Family: Thermococcaceae
Order: Thermococcales
Class: Thermococci or Protoarchaea
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI) 2261
Genome Sequence(s)
GenBank AE009950.1
EMBL AE009950
Gene Information
Gene NamemalE (PF1739)
NCBI Gene ID 1469617
Protein Information
Protein NameTMBP (Trehalose/maltose binding protein)
UniProtKB/SwissProt ID O51923
NCBI RefSeq NP_579468.1
EMBL-CDSAAL81863.1
UniProtKB Sequence >tr|O51923|O51923_PYRFU Trehalose/maltose binding protein OS=Pyrococcus furiosus GN=malE PE=1 SV=1 MNVKKVLLGLFLVGVLGIAVVASGCIGGQQTSTVTSTPTETSLQGKIVFAVGGAPNEIEY WKGVIAEFEKKYPGVTVELKRQATDTEQRRLDLVNALRGKSSDPDVFLMDVAWLGQFIAS GWLEPLDDYVQKDNYDLSVFFQSVINLADKQGGKLYALPVYIDAGLLYYRKDLLEKYGYS KPPETWQELVEMAQKIQSGERETNPNFWGFVWQGKQYEGLVCDFVEYVYSNGGSLGEFKD GKWVPTLNKPENVEALQFMVDLIHKYKISPPNTYTEMTEEPVRLMFQQGNAAFERNWPYA WGLHNADDSPVKGKVGVAPLPHFPGHKSAATLGGWHIGISKYSDNKALAWEFVKFVESYS VQKGFAMNLGWNPGRVDVYDDPAVVSKSPHLKELRAVFENAVPRPIVPYYPQLSEIIQKY VNSALAGKISPQEALDKAQKEAEELVKQYS
Sequence length 450 AA
Subcellular LocationMembrane
Function Binding protein-dependent ABC transporter mediating uptake of α-glucosides. It transports trehalose and maltose.
Protein Structure
PDB ID 1EUB
Glycosylation Status
Glycosylation Type N(Asn)- linked
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionConcanavalin A (ConA) binding, Periodic acid- Schiff reagent (PAS) staining.
Glycan Information
Glycan Annotation Glucose moieties.
Literature
Year of Identification2002
Year of Identification Month Wise2002.4
Reference1) Koning, S.M., Konings, W.N. and Driessen, A.J. (2002) Biochemical evidence for the presence of two alpha-glucoside ABC-transport systems in the hyperthermophilic archaeon Pyrococcus furiosus. Archaea, 1, 19-25. [PubMed: 15803655]
Author Koning, S.M., Konings, W.N. Driessen, A.J.
Research GroupDepartment of Microbiology, Groningen Biomolecular Sciences and Biotechnology Institute, University of Groningen, 90750 AA Haren, The Netherlands.
Corresponding Author Driessen, A.J.
ContactDepartment of Microbiology, Groningen Biomolecular Sciences and Biotechnology Institute, University of Groningen, 90750 AA Haren, The Netherlands.