ProGP213

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP213
Validation Status Uncharacterized
Organism Information
Organism NamePyrococcus furiosus DSM 3638
Domain Archaea
Classification Family: Thermococcaceae
Order: Thermococcales
Class: Thermococci or Protoarchaea
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI) 2261
Genome Sequence(s)
GenBank AE009950.1
EMBL AE009950
Gene Information
Gene NamemalE (PF1938)
NCBI Gene ID 1469818
Protein Information
Protein NameMDBP (Maltodextrin binding protein)
UniProtKB/SwissProt ID P58300
NCBI RefSeq NP_579667.1
EMBL-CDSAAL82062.1
UniProtKB Sequence >sp|P58300|MALE_PYRFU Maltotriose-binding protein OS=Pyrococcus furiosus GN=malE PE=1 SV=1 MRRATYAFALLAILVLGVVASGCIGGGTTTPTQTSPATQPTTTQTPTQTETQAVECGSGK VVIWHAMQPNELEVFQSLAEEYMALCPEVEIVFEQKPNLEDALKAAIPTGQGPDLFIWAH DWIGKFAEAGLLEPIDEYVTEDLLNEFAPMAQDAMQYKGHYYALPFAAETVAIIYNKEMV SEPPKTFDEMKAIMEKYYDPANEKYGIAWPINAYFISAIAQAFGGYYFDDKTEQPGLDKP ETIEGFKFFFTEIWPYMAPTGDYNTQQSIFLEGRAPMMVNGPWSINDVKKAGINFGVVPL PPIIKDGKEYWPRPYGGVKLIYFAAGIKNKDAAWKFAKWLTTSEESIKTLALELGYIPVL TKVLDDPEIKNDPVIYGFGQAVQHAYLMPKSPKMSAVWGGVDGAINEILQDPQNADIEGI LKKYQQEILNNMQG
Sequence length 434 AA
Subcellular LocationMembrane
Function Binding protein-dependent ABC transporter mediating uptake of α-glucosides. It transports maltotriose and higher maltooligosaccharides, but not maltose.
Protein Structure
PDB ID 1ELJ
Glycosylation Status
Glycosylation Type Information currently not available with us.
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionConcanavalin A (ConA) binding, Periodic acid- Schiff reagent (PAS) staining.
Literature
Year of Identification2002
Year of Identification Month Wise2002.4
Reference1) Koning, S.M., Konings, W.N. and Driessen, A.J. (2002) Biochemical evidence for the presence of two alpha-glucoside ABC-transport systems in the hyperthermophilic archaeon Pyrococcus furiosus. Archaea, 1, 19-25. [PubMed: 15803655]
Author Koning, S.M., Konings, W.N. Driessen, A.J.
Research GroupDepartment of Microbiology, Groningen Biomolecular Sciences and Biotechnology Institute, University of Groningen, 90750 AA Haren, The Netherlands.
Corresponding Author Driessen, A.J.
ContactDepartment of Microbiology, Groningen Biomolecular Sciences and Biotechnology Institute, University of Groningen, 90750 AA Haren, The Netherlands.