ProGP215

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP215
Validation Status Uncharacterized
Organism Information
Organism NameHelicobacter (Campylobacter) pylori 1061/J99
Domain Bacteria
Classification Family: Helicobacteraceae
Order: Campylobacterales
Class: Epsilonproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 85963
Genome Sequence(s)
GenBank AE001439.1
EMBL AE001439
Organism Additional Information Helicobacter pylori is a Gram-negative, microaerophilic, human gastric pathogen classified by WHO as a Type 1 carcinogen. Its lipopolysaccharide (LPS) O antigen is responsible for its virulence. Lewis antigens on its O polysaccharides mimic glycan structures on human cells and interact with the C-type lectin DC-SIGN on dendritic cells, thereby down-regulating an inflammatory response. It also causes chronic type B gastritis (a prerequisite for duodenal ulcers) and is linked with mucosa-associated lymphoid tissue (MALT) and with B-cell MALT lymphomas.
Gene Information
Gene NameflaB ( jhp_0107)
NCBI Gene ID 889505
Protein Information
Protein NameFlagellin B
UniProtKB/SwissProt ID Q9ZMV8
NCBI RefSeq NP_222828.1
EMBL-CDSAAD05686.1
UniProtKB Sequence >sp|Q9ZMV8|FLAB_HELPJ Flagellin B OS=Helicobacter pylori J99 GN=flaB PE=3 SV=3 MSFRINTNIAALTSHAVGVQNNRDLSSSLEKLSSGLRINKAADDSSGMAIADSLRSQSAN LGQAIRNANDAIGMVQTADKAMDEQIKILDTIKTKAVQAAQDGQTLESRRALQSDIQRLL EELDNIANTTSFNGQQMLSGSFSNKEFQIGAYSNTTVKASIGSTSSDKIGHVRMETSSFS GEGMLASAAAQNLTEVGLNFKQVNGVNDYKIETVRISTSAGTGIGALSEIINRFSNTLGV RASYNVMATGGTPVQSGTVRELTINGVEIGTVNDVHKNDADGRLTNAINSVKDRTGVEAS LDIQGRINLHSIDGRAISVHAASASGQVFGGGNFAGISGTQHAVIGRLTLTRTDARDIIV SGVNFSHVGFHSAQGVAEYTVNLRAVRGIFDANVASAAGANANGAQAETNSQGIGAGVTS LKGAMIVMDMADSARTQLDKIRSDMGSVQMELVTTINNISVTQVNVKAAESQIRDVDFAE ESANFSKYNILAQSGSFAMAQANAVQQNVLRLLQ
Sequence length 514 AA
Subcellular LocationSecreted
Function Flagellin is the subunit protein which polymerizes to form the filaments of bacterial flagella. Important for motility and virulence.
Glycosylation Status
Glycosylation Type O(Ser/Thr)- linked
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionImmunoblotting using antiglycan antiserum.
Glycan Information
Glycan Annotation Pseudaminic acid (Pse5Ac7Ac, 5,7-diacetamido-3,5,7,9-tetradeoxy-L-glycero-L-manno-nonulosonic acid). O-linkage Ser/Thr at 10 sites.
BCSDB ID4618
Literature
Year of Identification2002
Year of Identification Month Wise2002.5
Reference1) Schoenhofen, I.C., Lunin, V.V., Julien, J.P., Li, Y., Ajamian, E., Matte, A., Cygler, M., Brisson, J.R., Aubry, A., Logan, S.M. et al. (2006) Structural and functional characterization of PseC, an aminotransferase involved in the biosynthesis of pseudaminic acid, an essential flagellar modification in Helicobacter pylori. J Biol Chem, 281, 8907-8916. [PubMed: 16421095]
Author Schoenhofen, I.C., Lunin, V.V., Julien, J.P., Li, Y., Ajamian, E., Matte, A., Cygler, M., Brisson, J.R., Aubry, A., Logan, S.M. et al. (2006) Structural functional characterization of PseC, an aminotransferase involved in the biosynthesis of pseudaminic acid, an essential flagellar modification in Helicobacter pylori. J Biol Chem, 281, 8907-8916. [PubMed: 16421095]
Research GroupInstitute for Biological Sciences, National Research Council, Ottawa, Ontario K1A 0R6.
Corresponding Author functional characterization of PseC, an aminotransferase involved in the biosynthesis of pseudaminic acid, an essential flagellar modification in Helicobacter pylori. J Biol Chem, 281, 8907-8916. [PubMed: 16421095]
ContactInstitute for Biological Sciences, National Research Council, Ottawa, Ontario K1A 0R6.
ReferenceJosenhans, C., Vossebein, L., Friedrich, S. and Suerbaum, S. (2002) The neuA/flmD gene cluster of Helicobacter pylori is involved in flagellar biosynthesis and flagellin glycosylation. FEMS Microbiol Lett, 210, 165-172.
AuthorJosenhans, C., Vossebein, L., Friedrich, S. Suerbaum, S.
Research GroupInstitut für Hygiene und Mikrobiologie der Universität Würzburg, Josef-Schneider-Strasse 2, D-97080 Würzburg, Germany. 
Corresponding Author Suerbaum, S.
ContactInstitut für Hygiene und Mikrobiologie der Universität Würzburg, Josef-Schneider-Strasse 2, D-97080 Würzburg, Germany. 
ReferenceSchirm, M., Soo, E.C., Aubry, A.J., Austin, J., Thibault, P. and Logan, S.M. (2003) Structural, genetic and functional characterization of the flagellin glycosylation process in Helicobacter pylori. Mol Microbiol, 48, 1579-1592. [PubMed: 12791140]
AuthorSchirm, M., Soo, E.C., Aubry, A.J., Austin, J., Thibault, P. Logan, S.M.
Research GroupUniversity of Montreal, Department of Chemistry, Canada.
Corresponding Author Logan, S.M.
ContactUniversity of Montreal, Department of Chemistry, Canada.