ProGP22

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP22
Validation Status Uncharacterized
Organism Information
Organism NameTreponema pallidum subsp. pallidum Nichols
Domain Bacteria
Classification Family: Spirochaetaceae
Order: Spirochaetales
Class: Spirochaetes
Division or phylum: "Spirochaetes" or "Spirochaetae"
Taxonomic ID (NCBI) 160
Genome Sequence(s)
GenBank AE000520.1
EMBL AE000520
Gene Information
Gene NameflaB1 (TP_0868)
NCBI Gene ID 2611100
Protein Information
Protein NameFlagellin FlaB1
UniProtKB/SwissProt ID P21990
NCBI RefSeq NP_219303.1
EMBL-CDSAAC65834.1
UniProtKB Sequence >sp|P21990|FLAB1_TREPA Flagellar filament 34.5 kDa core protein OS=Treponema pallidum GN=flaB1 PE=1 SV=2 MIINHNMSAMFAQRTLGHTNVQVGKGIEKLSSGYRINRAGDDASGLAVSEKMRSQIRGLN QASTNASNGVNFIQVTEAYLQETTDIMQRIRELAIQAANGIYSAEDRMQIQVEVSQLVAE VDRIASSAQFNGMNLLTGRFSRTEGENVIGGSMWFHIGANMDQRMRVYIGTMTAVALGVR NGVDESIMSIETADSANKSIGTIDAALKRINKQRADLGGYQNRMEYTVVGLDIAAENLQA AESRIRDANIAKQMVEYTKNQVLTQSGTAMLAQANTSAQSILSILR
Sequence length 286 AA
Subcellular LocationPeriplasm
Function Flagellar 35 kDa core protein. It is the major component of the endoflagella which are required for motility of Treponemes.
Glycosylation Status
Glycosylation Type Information currently not available with us.
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionIntrinsic [14C]glucosamine-labeling, periodate oxidation-DIG (digoxigenin) hydrazide labeling
Literature
Year of Identification1984
Year of Identification Month Wise1984.2
Reference1) Wyss, C. (1998) Flagellins, but not endoflagellar sheath proteins, of Treponema pallidum and of pathogen-related oral spirochetes are glycosylated. Infect Immun, 66, 5751-5754. [PubMed: 9826350]
AuthorWyss, C.
Research GroupInstitut für Orale Mikrobiologie und Allgemeine Immunologie, Zentrum für Zahn-, Mund- und Kieferheilkunde der Universität Z urich, CH-8028 Zürich, Switzerland.
Corresponding Author Wyss, C.
ContactInstitut für Orale Mikrobiologie und Allgemeine Immunologie, Zentrum für Zahn-, Mund- und Kieferheilkunde der Universität Z urich, CH-8028 Zürich, Switzerland.
ReferenceMoskophidis, M. and Muller, F. (1985) Identification of glycosylated protein antigens of Treponema pallidum and Treponema phagedenis. Zentralbl Bakteriol Mikrobiol Hyg A, 259, 468-476. [PubMed: 3901616]
AuthorMoskophidis, M. Muller, F.
Research GroupFrom the Department of Medicine, School of Medicine, University of Washington, Seattle,
Corresponding Author Muller, F.
ContactFrom the Department of Medicine, School of Medicine, University of Washington, Seattle,
Authorhttps://www.ncbi.nlm.nih.gov/pubmed/ 6389370
Research GroupMoskophidis, M. Muller, F.
Contact Muller, F.