ProGP230

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP230
Validation Status Uncharacterized
Organism Information
Organism NameStreptococcus gordonii strain M99
Domain Bacteria
Classification Family: Streptococcaceae
Order: Lactobacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI) 1302
Genome Sequence(s)
EMBL AY028381
Gene Information
Gene NamegspB
Protein Information
Protein NameGspB
UniProtKB/SwissProt ID Q939N5
EMBL-CDSAAL13053.1
UniProtKB Sequence >tr|Q939N5|Q939N5_STRGN Platelet binding protein GspB OS=Streptococcus gordonii GN=gspB PE=4 SV=1 MFFKRQKGQYHEVERVTRFKLIKSGKHWLRAATSQFGLLRLMKGSDVSSTEVKVVEEQSV EKSGLNYLKGIIATGAVLGGAVVTSSSVYAEEEQAHEKVIDTRDVLATRGEAVLSEEAAT TLSSTEANPVESLSDTLSASESTSASSSVSTSISVSESFSVSGSLSYSTSLSQSVSASAS ASESLSVSSSASDSVSASTSTSASASQSVSASQKSTISTSESTRSESSQQSTEASSQTGR RRTRRAVTESAPNVEYHDVKGDMIQSVTTSFDDTSRLLTWTINLTPRQVKSNLGALVSIS GNQETRTVTINGKNAANGGVYNSGGAWNLYTGESVNNNVLRITTQVNDTGGEVKLGLRLV TSDKKITKTNLPLEFSQVAATTNGSWDKAGYNTTIVEKDTERPVVNVPSEITVYRGESFE YFATVTDNSNAFDLAKTVVRWLYNNQPGRGTEWLQYSVTQVGNQLKVRIFGNVPIDTTIG DYTRYVVATDAAGNVNATQTEMGNAAVDKTSVNGQFKLIIRFRIKTPENTVFVNNPNQLT EVEKNLVREAVKKSNPDLRAQDVLNSNYVTGITVSNNGTTTITYRDGRKDIIDGSKFIDT RAGSISKSQSTSNSISVSLSKSESASASLVTSKLNSISSSASVSASTSISTSGSVSASES ASTSSSVSASESASTSASVSASESASTSASVSASTSASTSASVSASTSASTSASTSASKS ASTSASVSASTSASTSASVSASESASTSASVSASTSASTSASVSASTSASTSASVSASES ASTSASVSASTSASTSASVSASESASTSASVSASTSASTSASVSASASASTSASVSASTS ASTSASVSASASASTSASVSASTSASTSASVSASESASTSASVSASESASTSASVSASES ASTSASVSASESASTSASVSASTSASTSASVSASESASTSASVSASESASTSASVSASES ASTSASVSASESASTSASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSASTS ASTSASVSASESASTSASVSASESASTSASVSASTSASTSASVSASESASTSASVSASES ASTSASESASESASTSASVSASESASTSASVSASESSSTSASVSASESSSTSASVSASES ASTSASVSASESASTSASESASESASTSASVSASESASTSASVSASESASTSASVSASES VSTSASVSASESASTSASVSASESASTSASESASESASTSASVSASESASTSASVSASES ASTSASVSASTSASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASES VSTSASVSASESASTSASVSASESASTSASESASESASTSASVSASESASTSASVSASES ASTSASVSASTSASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASTS ASTSASVSASESASTSTSVSTSTSASTSASVSASESASTSASVSASESASTSASVSASTS ASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASTS ASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASES ASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASES ASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASES ASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASES ASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASES ASTSASVSASTSTSTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASES ASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASES ASTSASVSASTSASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASES ASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASKS ASTSESASTSASVSASESASTSASVSASESASTSASVSASESVSTSASVSASDSASISAS VLASESASTSASVSASESASTSASVSASESASTSASVSASESASTSSSVSASESASTSAS VSASESASTSASVSASTSASTSASVSASESASTSASVSASESASTSASVSASESASTSAS VSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASTSASTSAS VSASESASTSASVSSSESASTSASVSASESASTSASVSASESASTSASVSASESASTSAS VSASESASTSASVSASTSASTSASVSASESASTSASVSASESASTSASVSASESASTSAS VSASESASTSASVSASTSASTSASVSASESASTSASVSASESASTSASVSASTSASTSAS VSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSAS VSASESASTSASVSASESASTSASVSASMSASTSASVSVSESTSTSASVSANESASTSAS VSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSAS VSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASTSASTSAS VSANESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSAS VSASTSASTSASVSANESASTSASVSASESASTSASVSASESASTSASVSASESASTSAS VSASESASTSASVSASTSASTSASVSASESASTSASASASESASTSASVSASESASTSAS VSASESASTSASVSASESASTNASVSVSESMSVSESLSLSISTSVLHSQLNDIYESELYS LSLSESLSASQSLSQSLSESQSSSASQSMHDRISKGQLPRTGESENKASILALGLGALGL AFKKRKKNESED
Sequence length 3072 AA
Subcellular LocationSecreted (surface anchored)
Function 286-kDa GspB is a platelet binding protein.
Glycosylation Status
Glycosylation Type Information currently not available with us.
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionConA binding, DIG (digoxigenin) Glycan detection.
Glycan Information
Glycan Annotation Approx. 10% (wt/wt) total carbohydrate is present in GspB105 and approx. 9% (wt/wt) carbohydrate in GspB194. Carbohydrates contain N-acetylglucosamine and some amounts of glucose or mannose.
Literature
Additional CommentTruncated derivatives of GspB- GspB105, GspB274 and GspB194 are also glycosylated. These are freely secreted. Gtf and Orf4 (glycosyltransferases) mediate intracellular glycosylation of GspB. Gly and Nss also contribute to this process. These are encoded in the gspB-sec operon. Mutation of one of them abolishes GspB expression. Two serine-rich repeats (SRR1 and SRR2) are glycosylated. Glycosylation is essential for the GspB solubility.
Year of Identification2004
Year of Identification Month Wise2004.2
ReferenceTakamatsu, D., Bensing, B.A. and Sullam, P.M. (2004) Four proteins encoded in the gspB-secY2A2 operon of Streptococcus gordonii mediate the intracellular glycosylation of the platelet-binding protein GspB. J Bacteriol, 186, 7100-7111. [PubMed: 15489421]
AuthorTakamatsu, D., Bensing, B.A. Sullam, P.M.
Research GroupDivision of Infectious Diseases, VA Medical Center (111W), 4150 Clement Street, San Francisco, CA 94121, USA.
Corresponding Author Sullam, P.M.
ContactDivision of Infectious Diseases, VA Medical Center (111W), 4150 Clement Street, San Francisco, CA 94121, USA.
Reference1) Bensing, B.A., Gibson, B.W. and Sullam, P.M. (2004) The Streptococcus gordonii platelet binding protein GspB undergoes glycosylation independently of export. J Bacteriol, 186, 638-645. [PubMed: 14729688]
AuthorBensing, B.A., Gibson, B.W. and Sullam, P.M
Research GroupDivision of Infectious Diseases, Veterans Affairs Medical Center, San Francisco, California 94121, USA.
Corresponding Author Sullam, P.M
ContactDivision of Infectious Diseases, Veterans Affairs Medical Center, San Francisco, California 94121, USA.