ProGP233

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP233
Validation Status Characterized
Organism Information
Organism NameListeria monocytogenes CLIP23485
Domain Bacteria
Classification Family: Listeriaceae
Order: Bacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI) 1639
Genome Sequence(s)
GenBank AL591976.1
EMBL AL591976
Organism Additional Information Listeria monocytogenes is a Gram-positive bacterium that is the causative agent of a severe food-borne infection termed listeriosis. Meningitis, septicemia, spontaneous abortion, perinatal infections, and gastroenteritis symptomize listeriosis.
Gene Information
Gene NameflaA ( lmo0690)
NCBI Gene ID 987167
GenBank Gene Sequence 987167
Protein Information
Protein NameFlagellin FlaA
UniProtKB/SwissProt ID Q02551
NCBI RefSeq NP_464217.1
EMBL-CDSCAC98768.1
UniProtKB Sequence >sp|Q02551|FLAA_LISMO Flagellin OS=Listeria monocytogenes GN=flaA PE=3 SV=2 MKVNTNIISLKTQEYLRKNNEGMTQAQERLASGKRINSSLDDAAGLAVVTRMNVKSTGLD AASKNSSMGIDLLQTADSALSSMSSILQRMRQLAVQSSNGSFSDEDRKQYTAEFGSLIKE LDHVADTTNYNNIKLLDQTATGAATQVSIQASDKANDLINIDLFNAKGLSAGTITLGSGS TVAGYSALSVADADSSQQATEAIDELINNISNGRALLGAGMSRLSYNVSNVNNQSIATKA SASSIEDADMAAEMSEMTKYKILTQTSISMLSQANQTPQMLTQLINS
Sequence length 287 AA
Subcellular LocationSecreted
Function Flagellin is the subunit protein which polymerizes to form the filaments of bacterial flagella.
Glycosylation Status
Glycosylation Type O (Thr) linked
Experimentally Validated Glycosite(s) in Full Length ProteinT141, T145, T173, T175, S180
Experimentally Validated Glycosite(s ) in Mature ProteinT141, T145, T173, T175, S180
Glycosite(s) Annotated Protein Sequence >sp|Q02551|FLAA_LISMO Flagellin OS=Listeria monocytogenes GN=flaA PE=3 SV=2 MKVNTNIISLKTQEYLRKNNEGMTQAQERLASGKRINSSLDDAAGLAVVTRMNVKSTGLD AASKNSSMGIDLLQTADSALSSMSSILQRMRQLAVQSSNGSFSDEDRKQYTAEFGSLIKE LDHVADTTNYNNIKLLDQTAT*(141)GAAT*(145)QVSIQASDKANDLINIDLFNAKGLSAGT*(173)IT*(175)LGSGS*(180) TVAGYSALSVADADSSQQATEAIDELINNISNGRALLGAGMSRLSYNVSNVNNQSIATKA SASSIEDADMAAEMSEMTKYKILTQTSISMLSQANQTPQMLTQLINS
Sequence Around Glycosites (21 AA) NNIKLLDQTATGAATQVSIQA
LLDQTATGAATQVSIQASDKA
LFNAKGLSAGTITLGSGSTVA
NAKGLSAGTITLGSGSTVAGY
SAGTITLGSGSTVAGYSALSV
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionDIG glycan detection
Technique(s) used for Glycosylated Residue(s) Detection Alkaline hydrolysis and MS/MS (tandem mass spectrometry)
Glycan Information
Glycan Annotation Linkage: β-GlcNAc-Thr/Ser.
Protein Glycosylation linked (PGL) gene(s)
OST ProGT IDProGT18
Literature
Year of Identification2004
Year of Identification Month Wise2004.10.1
Year of Validation 2004
Reference1) Schirm, M., Kalmokoff, M., Aubry, A., Thibault, P., Sandoz, M. and Logan, S.M. (2004) Flagellin from Listeria monocytogenes is glycosylated with beta-O-linked N-acetylglucosamine. J Bacteriol, 186, 6721-6727. [PubMed: 15466023]
AuthorSchirm, M., Kalmokoff, M., Aubry, A., Thibault, P., Sandoz, M. and Logan, S.M.
Research GroupDepartment of Chemistry, University of Montreal, Montreal, Quebec, Canada.
Corresponding Author Logan, S.M.
ContactDepartment of Chemistry, University of Montreal, Montreal, Quebec, Canada.