ProGP234

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP234
Validation Status Uncharacterized
Organism Information
Organism NameCorynebacterium glutamicum (Brevibacterium flavum) ATCC 13032
Domain Bacteria
Classification Family: Corynebacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 1718
Genome Sequence(s)
GenBank BX927150.1
EMBL BX927150
Gene Information
Gene Namerpf2 (cg1037)
NCBI Gene ID 3342641
GenBank Gene Sequence 3342641
Protein Information
Protein NameResuscitation promoting factor 2 (Rpf2)
UniProtKB/SwissProt ID Q6M6N7
NCBI RefSeq YP_225201.1
EMBL-CDSCAF19615.1
UniProtKB Sequence >tr|Q6M6N7|Q6M6N7_CORGL Putative RPF2, secreted protein OS=Corynebacterium glutamicum GN=cg1037 PE=4 SV=1 MAPHQKSRINRINSTRSVPLRLATGGVLATLLIGGVTAAATKKDIIVDVNGEQMSLVTMS GTVEGVLAQAGVELGDQDIVSPSLDSSISDEDTVTVRTAKQVALVVEGQIQNVTTTAVSV EDLLQEVGGITGADAVDADLSETIPESGLKVSVTKPKIISINDGGKVTYVSLAAQNVQEA LELRDIELGAQDRINVPLDQQLKNNAAIQIDRVDNTEITETVSFDAEPTYVDDPEAPAGD ETVVEEGAPGTKEVTRTVTTVNGQEESSTVINEVEITAAKPATISRGTKTVAANSVWDQL AQCESGGNWAINTGNGFSGGLQFHPQTWLAYGGGAFSGDASGASREQQISIAEKVQAAQG WGAWPACTASLGIR
Sequence length 374 AA
Subcellular LocationCell surface (secreted)
Function Rpf2 plays a role in intercellular communication and growth stimulation of C. glutamicum.
Glycosylation Status
Glycosylation Type Information currently not available with us.
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionDIG (digoxigenin) glycan detection using using anti-DIG antibody
Glycan Information
Glycan Annotation Galactose and mannose are the constituents of the oligosaccharide that were identified by GCMS.
Protein Glycosylation linked (PGL) gene(s)
OST ProGT IDProGT12
Accessory Gene(s)Progt IDProGT12.1
Literature
Additional CommentRpf2 is the first example of a glycoprotein in C. glutamicum.
Protein mannosyltransferase, pmt gene (cg1014) has been shown to glycosylate secreted proteins including Rpf2 by gene deletion studies. This gene has also been found to possess significant similarity to eukaryotic PMTs and an orthologue of M. tuberculosis, Rv1002c.
Year of Identification2004
Year of Identification Month Wise2004.11
ReferenceHartmann, M., Barsch, A., Niehaus, K., Puhler, A., Tauch, A. and Kalinowski, J. (2004) The glycosylated cell surface protein Rpf2, containing a resuscitation-promoting factor motif, is involved in intercellular communication of Corynebacterium glutamicum. Arch Microbiol, 182, 299-312. [PubMed: 15480574]
AuthorHartmann, M., Barsch, A., Niehaus, K., Puhler, A., Tauch, A. Kalinowski, J.
Research GroupLehrstuhl für Genetik, Universität Bielefeld, Universitätsstrasse 25, Bielefeld, Germany
Corresponding Author Kalinowski, J.
ContactLehrstuhl für Genetik, Universität Bielefeld, Universitätsstrasse 25, Bielefeld, Germany
Reference1) Mahne, M., Tauch, A., Puhler, A. and Kalinowski, J. (2006) The Corynebacterium glutamicum gene pmt encoding a glycosyltransferase related to eukaryotic protein-O-mannosyltransferases is essential for glycosylation of the resuscitation promoting factor (Rpf2) and other secreted proteins. FEMS Microbiol Lett, 259, 226-233. [PubMed: 16734784]
Author Kalinowski, J.
Research GroupInstitut für Genomforschung, Centrum für Biotechnologie, Bielefeld, Germany.
Corresponding Author Mahne, M., Tauch, A., Puhler, A. Kalinowski, J.
ContactInstitut für Genomforschung, Centrum für Biotechnologie, Bielefeld, Germany.