ProGP236

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP236
Validation Status Uncharacterized
Organism Information
Organism NamePyrococcus furiosus DSM 3638
Domain Archaea
Classification Family: Thermococcaceae
Order: Thermococcales
Class: Thermococci or Protoarchaea
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI) 2261
Genome Sequence(s)
GenBank AE009950.1
EMBL AE009950
Gene Information
Gene NamecipB (PF1408)
NCBI Gene ID 1469284
Protein Information
Protein NameCipB (putative dipeptide-binding protein)
UniProtKB/SwissProt ID Q8U121
NCBI RefSeq NP_579137.1
EMBL-CDSAAL81532.1
UniProtKB Sequence >tr|Q8U121|Q8U121_PYRFU Putative dipeptide-binding protein OS=Pyrococcus furiosus GN=PF1408 PE=4 SV=1 MKKGLLAILLVGVMVLGTFGSGCIGGGTQTQTQTPTETGSPTQTTTPSGVTQAILELGKV TVVDTGTAIVVVGPKGEKPSVSIPSGKKVITVTYVVDEQNTPSVKELMEQGQGFGAINPA FFRDTNVDALVIAARRETNPEVRTEIFKALYILGNYYVPEVILGQNRQLRVYWDWVKGRY YHPTLPERYDLLWEDPNAPVVDTGIGSYKNDPETYVIATIGWPESFDPAWTYETFGWEIW HEIGDTLVTYWKEETEQVTPDLAVAWAHNKEGTEWYFVIRGGVKAYDPWNDKTYPIDATD VVFTFWRVARLGHSVSWMVTEFMNVSASQALTEEEFNNYVKNNPLIAEYNGKTAEIKSLQ DLLNFFGYNGETAGVFKLVLPHPYAAVLNIVADPFLSVVPMEYLLGDKYEEALKASNYGK NPDAWEAYVQEGVDDPTHQLMHKYPVGTGPFYVKEYQENSYIVLEYNPYYWNATSNPGHK RVIYIINNDAVARVQLLTTGTADVAAIPTDKIEDVQGVTKDGYKVVVQTDILLPVLTFIV FNTQKEPFNDVKVRQALAYAIPYDQIAKVVYNNLLERNWGPIPKPWPGYTEYGIIKYEYN IAKAKQMLQEAGVDPSKYSITLIYNAGNTQREKVMTLIQNVWSQLGFRVTVESYEWPVYL SKTEHGDYDVYIVGWVPDYLDSDNWVGPFLYGATEFSEINIEVSG
Sequence length 705 AA
Subcellular LocationMembrane associated
Function Cold induced protein. Up-regulated in response to the cold stress.
Glycosylation Status
Glycosylation Type Information currently not available with us.
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionPro-Q Emerald 300 staining.
Literature
Year of Identification2005
Year of Identification Month Wise2005.1
Reference1) Weinberg, M.V., Schut, G.J., Brehm, S., Datta, S. and Adams, M.W. (2005) Cold shock of a hyperthermophilic archaeon: Pyrococcus furiosus exhibits multiple responses to a suboptimal growth temperature with a key role for membrane-bound glycoproteins. J Bacteriol, 187, 336-348. [PubMed: 15601718]
Author Weinberg, M.V., Schut, G.J., Brehm, S., Datta, S. Adams, M.W.
Research GroupDepartment of Biochemistry and Molecular Biology, Life Sciences Bldg., University of Georgia, Athens, GA 30602-7229, USA
Corresponding Author Adams, M.W.
ContactDepartment of Biochemistry and Molecular Biology, Life Sciences Bldg., University of Georgia, Athens, GA 30602-7229, USA