ProGP238

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP238
Validation Status Characterized
Organism Information
Organism NameGeobacillus tepidamans GS5-97T
Domain Bacteria
Classification Family: Bacillaceae
Order: Bacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI) 265948
Genome Sequence(s)
GenBank AY883421
EMBL AY883421
Gene Information
Gene NamesgtA
Protein Information
Protein NameSgtA
UniProtKB/SwissProt ID Q58R21
EMBL-CDSAAX46285.1
UniProtKB Sequence >tr|Q58R21|Q58R21_9BACI SgtA OS=Geobacillus tepidamans GN=sgtA PE=4 SV=1 MSKKKAIKLATASAIAASAFVAANPNASEAATNVDAVVSQAKAQMRNAYYTYSHTVTNTG EFADIKAVYAEYNKAKKAYADAVALVKKAGGANKDAYLADLEATYEVYITSRVIPYIDAY NYAVKLDAMRQELQAAVDAKDLAKVEELYHKISYELKSRTVILDRVYGQTTRDLLRSQFK AAAQQLRDSLIYDVTVSMKLKAAEEATNKGDLAAAEKALAEAQDALTKATAFKADLTTKQ ATVKAAYEAKVAPAVVGVSAVNSRTVQIKFNKPIDASTVLVDKGTTDTSDDTLKTTSIVF TALDGQPAISQTDIKASLSDDKKTLTLVAANSDFFTKRYVVDIKNVKTTDGKDVPAYTTT IDTTDSVRPAVLSYSYADNGLTLKVKFSEPLNSVGTVKLYDGTTEISVSPSFTAGSDEMT INLASSSVPVNKALTLKIFGAVDYNGNVINPNPAELTVMKTTVDTTKPTVQSVEAVNDKT VKVTFSEKLLGNPTIKIGGTTAASVSVDSTGLVYTATLNSAQLGIQAVEVSSYTDLAGNV GDAYTKVVELKADTTAPKLVSSQVVKINGIENLVLTFDEEVTTQNNITVVSSNDYYVDEN NVRKQVGVTLTTNSTNFKLYNPVNGKSKSVALDISSLPKGTYTVTLPTGATALVKDLASN PNAYAEGKQITFVRGTDSLTTKPALDTNVSTNGVEVVDNNTLRFTFTQNLDASALNLSNF NINGVALSKAVFDGATNKILVTLAPGANTWTGTHVITVSNIKNVSGIAMDTVTTTESMNE NVAPTFTATLTSADVIKVTFSEPVAHSTLSNAITGNNFTVKVDGTLNNVTGVYTDSAATT PVSATGNTGYKTVYLKLATPVTDLTKPITVSATNLVDVSAEGASPTVVGNTVSSDVVNVA K
Sequence length 901 AA
Subcellular LocationSurface
Function Surface layer glycoprotein
Glycosylation Status
Glycosylation Type O- (Ser) linked
Experimentally Validated Glycosite(s) in Full Length ProteinS792
Experimentally Validated Glycosite(s ) in Mature ProteinS792
Glycosite(s) Annotated Protein Sequence >tr|Q58R21|Q58R21_9BACI SgtA OS=Geobacillus tepidamans GN=sgtA PE=4 SV=1 MSKKKAIKLATASAIAASAFVAANPNASEAATNVDAVVSQAKAQMRNAYYTYSHTVTNTG EFADIKAVYAEYNKAKKAYADAVALVKKAGGANKDAYLADLEATYEVYITSRVIPYIDAY NYAVKLDAMRQELQAAVDAKDLAKVEELYHKISYELKSRTVILDRVYGQTTRDLLRSQFK AAAQQLRDSLIYDVTVSMKLKAAEEATNKGDLAAAEKALAEAQDALTKATAFKADLTTKQ ATVKAAYEAKVAPAVVGVSAVNSRTVQIKFNKPIDASTVLVDKGTTDTSDDTLKTTSIVF TALDGQPAISQTDIKASLSDDKKTLTLVAANSDFFTKRYVVDIKNVKTTDGKDVPAYTTT IDTTDSVRPAVLSYSYADNGLTLKVKFSEPLNSVGTVKLYDGTTEISVSPSFTAGSDEMT INLASSSVPVNKALTLKIFGAVDYNGNVINPNPAELTVMKTTVDTTKPTVQSVEAVNDKT VKVTFSEKLLGNPTIKIGGTTAASVSVDSTGLVYTATLNSAQLGIQAVEVSSYTDLAGNV GDAYTKVVELKADTTAPKLVSSQVVKINGIENLVLTFDEEVTTQNNITVVSSNDYYVDEN NVRKQVGVTLTTNSTNFKLYNPVNGKSKSVALDISSLPKGTYTVTLPTGATALVKDLASN PNAYAEGKQITFVRGTDSLTTKPALDTNVSTNGVEVVDNNTLRFTFTQNLDASALNLSNF NINGVALSKAVFDGATNKILVTLAPGANTWTGTHVITVSNIKNVSGIAMDTVTTTESMNE NVAPTFTATLTS*(792)ADVIKVTFSEPVAHSTLSNAITGNNFTVKVDGTLNNVTGVYTDSAATT PVSATGNTGYKTVYLKLATPVTDLTKPITVSATNLVDVSAEGASPTVVGNTVSSDVVNVA K
Sequence Around Glycosites (21 AA) VAPTFTATLTSADVIKVTFSE
Technique(s) used for Glycosylation DetectionPeriodic acid-Schiff (PAS) staining and chemical deglycosylation
Technique(s) used for Glycosylated Residue(s) Detection ESI-QTOF-MS (electrospray ionization quadrupole-time-of-flight mass spectrometry)
Glycan Information
Glycan Annotation Linkage: β-D-Gal-Ser/Thr.
[→2)-α-L-Rhap-(1→3)-α-D-Fucp-(1→]n=~20. Rhamnose residue at the nonreducing end of the terminal repeating unit of the glycan chain is di-substituted. (R)-N-acetylmuramic acid found in an α-linkage to carbon 3 of the terminal rhamnose residue, serving as capping motif of an S-layer glycan. In addition, that rhamnose is substituted at position 2 with a β-N-acetylglucosamine residue. The S-layer glycan chains are bound via the trisaccharide core →2)-α-L-Rhap-(1→3)-α-L-Rhap-(1→3)-α-L-Rhap-(1→ to carbon 3 of β-D-galactose, which is attached to S and T residues.
BCSDB ID23139
Technique(s) used for Glycan Identification HPAEC/PAD (high performance anion-exchange chromatography/pulsed amperometric detection), 1H and 13C NMR spectroscopy including 2D NOESY (nuclear Overhauser enhancement spectroscopy), HMBC (heteronuclear multiple bond correlation spectroscopy) and TOCSY (total correlation spectroscopy)
Literature
Year of Identification2005
Year of Identification Month Wise2005.4.27
Year of Validation 2007
ReferenceMessner, P., Steiner, K., Zarschler, K. and Schaffer, C. (2008) S-layer nanoglycobiology of bacteria. Carbohydr Res, 343, 1934-1951. [PubMed: 18336801]
Author Messner, P., Steiner, K., Zarschler, K. and Schaffer, C.
Research GroupUniversity of Natural Resources and Applied Life Sciences, Vienna, Center for NanoBiotechnology A-1180 Vienna, Gregor-Mendel-Strasse 33, Austria.
Corresponding Author Schaffer, C
ContactUniversity of Natural Resources and Applied Life Sciences, Vienna, Center for NanoBiotechnology A-1180 Vienna, Gregor-Mendel-Strasse 33, Austria.
Reference Zayni, S., Steiner, K., Pfostl, A., Hofinger, A., Kosma, P., Schaffer, C. and Messner, P. (2007) The dTDP-4-dehydro-6-deoxyglucose reductase encoding fcd gene is part of the surface layer glycoprotein glycosylation gene cluster of Geobacillus tepidamans GS5-97T. Glycobiology, 17, 433-443. [PubMed: 17202151]
Author Zayni, S., Steiner, K., Pfostl, A., Hofinger, A., Kosma, P., Schaffer, C. Messner, P.
Research GroupCenter for NanoBiotechnology, University for Soil Culture Vienna, A-1190 Vienna, Austria.
Corresponding Author Messner, P.
ContactCenter for NanoBiotechnology, University for Soil Culture Vienna, A-1190 Vienna, Austria.
Reference Zayni, S., Steiner, K., Pfostl, A., Hofinger, A., Kosma, P., Schaffer, C. and Messner, P. (2007) The dTDP-4-dehydro-6-deoxyglucose reductase encoding fcd gene is part of the surface layer glycoprotein glycosylation gene cluster of Geobacillus tepidamans GS5-97T. Glycobiology, 17, 433-443. [PubMed: 17202151]
Author Zayni, S., Steiner, K., Pfostl, A., Hofinger, A., Kosma, P., Schaffer, C. Messner, P.
Research GroupCenter for NanoBiotechnology, University for Soil Culture Vienna, A-1190 Vienna, Austria.
Corresponding Author Messner, P.
ContactCenter for NanoBiotechnology, University for Soil Culture Vienna, A-1190 Vienna, Austria.
ReferenceKahlig, H., Kolarich, D., Zayni, S., Scheberl, A., Kosma, P., Schaffer, C. and Messner, P. (2005) N-acetylmuramic acid as capping element of alpha-D-fucose-containing S-layer glycoprotein glycans from Geobacillus tepidamans GS5-97T. J Biol Chem, 280, 20292-20299. [PubMed: 15781455]
Author Kahlig, H., Kolarich, D., Zayni, S., Scheberl, A., Kosma, P., Schaffer, C. Messner, P.
Research GroupDepartment of Organic Chemistry, University of Vienna, Austria.
ContactDepartment of Organic Chemistry, University of Vienna, Austria.