ProGP245

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP245
Validation Status Uncharacterized
Organism Information
Organism NameStreptococcus sanguis SK36
Domain Bacteria
Classification Family: Streptococcaceae
Order: Lactobacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI) 388919
Genome Sequence(s)
GenBank CP000387.1
EMBL CP000387
Gene Information
Gene NamesrpA (SSA_0829)
NCBI Gene ID 4806103
Protein Information
Protein NameSrpA
UniProtKB/SwissProt ID A3CM52
NCBI RefSeq YP_001034807.1
EMBL-CDSABN44257.1
UniProtKB Sequence >tr|A3CM52|A3CM52_STRSV Platelet-binding glycoprotein OS=Streptococcus sanguinis (strain SK36) GN=srpA PE=4 SV=1 MFFKRQKGKYHEVERVTRFKLIKSGKHWLRAATSQFGLFRSMKGGGLSSIELKVTEEQVT DKKSGIDFLRGIVATGAVLGGAVVTSTTVHAEEGQALEKVIDTTDVLATRGETVLGEESS AAEAATATASSHTESESVSDTSSASASASVSASISASISASESMSQFSSASISASTSQAV SDSLSVSESLSVSSSTSDSVSASQPASTSASSKSESTVNSQSASSETNRSSTNNGSTSSS SETARVRKRRATDTTPPTITVPSDIIAYRGEEFEFYFEITDDSGQVKNIELSTFGKPLGL NWLEYSEDNFNVPGNATSDNPLRVRVHGTVPLNEPIPADKNRAQFTRTIRAWDAAGNVSS NITFVIKYRAQTDKYNPADPTITYVDRLSSLSPSEKNAVEAAVRAANPQIPAAARITVSA NGTVTITYPDSSTDTITANRVVKDLASSRSALTSASTSASTSASVSASTSASLSASTSAS QSIVDSKSASVSASTSASTSASTSASVSASTSASTSASVSASTSASASASVSASTSASTS ASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSASTSASTS ASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSASTSASTS ASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSASTSASTS ASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSASTSASTS ASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSASTSASTS ASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSASASASTSASVSASTSASTS ASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSASTSASTS ASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSASTSASTS ASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSASTSASTS ASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSASTSASTSSSAKASESASTS ASVSASTSASTSASVSASTSASTSASVSASASASTSASVSASTSASTSASVSASTSASTS ASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSASESASTSASVSASTSASTS ASVSASESASTSSSAKASESASTSASVSASTSASTSASVSASTSASTSASVSASTSASTS ASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSASTSASTS ASVSASESASTSSSAKASESASTSASVSASESASTSASVSVSESASTSASVSTSTSASTS ASVSASESASTSASASASESTSVRASALALASISASVSASESASTSASLSGSESASISDS QSISESTSVSISTSVLHSQLDLVHEKEFYSLSLSTSESLSAAVSLSELARVSQSVSESLS TSLSASQSTSESLSASARQSELDLISRGRLPQTGETESKASILALGLGALGLAFKRRKKK SDSEE
Sequence length 1625 AA
Function Platelet-binding glycoprotein.
Glycosylation Status
Glycosylation Type N- (Asn) linked
Technique(s) used for Glycosylation DetectionLectin WGA (wheat germ agglutinin) binding.
Glycan Information
Glycan Annotation Linkage: GlcNAc-Asn.
Literature
Year of Identification2005
Year of Identification Month Wise2005.04
ReferencePlummer, C., Wu, H., Kerrigan, S.W., Meade, G., Cox, D. and Ian Douglas, C.W. (2005) A serine-rich glycoprotein of Streptococcus sanguis mediates adhesion to platelets via GPIb. Br J Haematol, 129, 101-109. [PubMed: 15801962]
Author Plummer, C., Wu, H., Kerrigan, S.W., Meade, G., Cox, D. Ian Douglas, C.W.
Research GroupDepartment of Oral Pathology, School of Clinical Dentistry, University of Sheffield, Sheffield, UK.
Corresponding Author Ian Douglas, C.W.
ContactDepartment of Oral Pathology, School of Clinical Dentistry, University of Sheffield, Sheffield, UK.