ProGP247

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP247
Validation Status Uncharacterized
Organism Information
Organism NameBacillus anthracis
Domain Bacteria
Classification Family: Bacillaceae
Order: Bacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI) 1392
Genome Sequence(s)
GenBank AE016879.1
EMBL AE016879
Organism Additional Information Bacillus anthracis is a Gram-positive bacterium that forms spores, the causal agent of anthrax. This lethal infection involves both toxaemia and septicaemia.
Gene Information
Gene NamebclB (BA_2450)
NCBI Gene ID 1084937
Protein Information
Protein NameBclB (collagen-like protein)
UniProtKB/SwissProt ID Q81QH5
NCBI RefSeq NP_844826.1
EMBL-CDSAAP26312.1
UniProtKB Sequence >tr|Q81QH5|Q81QH5_BACAN Spore surface glycoprotein BclB OS=Bacillus anthracis GN=blcB PE=4 SV=1 MKQNDKLWLDKGIIGPENIGPTFPVLPPIHIPTGITGATGATGITGATGPTGTTGATGAT GITGVTGATGITGVTGATGITGVTGATGITGVTGPTGITGATGPTGITGATGPAGITGVT GPTGITGATGPTGTTGVTGPTGDTGLAGATGPTGATGLAGATGPTGDTGATGPTGATGLA GATGPTGATGLTGATGATGATGGGAIIPFASGTTPALLVNAVLANTGTLLGFGFSQPGIA PGVGGTLTILPGVVGDYAFVAPRDGIITSLAGFFSATAALAPLTPVQIQMQIFIAPAASN TFTPVAPPLLLTPALPAIAIGTTATGIQAYNVPVVAGDKILVYVSLTGASPIAAVAGFVS AGLNIV
Sequence length 366 AA
Subcellular LocationSurface
Function Spore surface glycoprotein. It is the constituent of the exosporium, a loose covering around the spore.
Glycosylation Status
Technique(s) used for Glycosylation DetectionGas chromatography-mass spectrometry (GC-MS) and tandem mass spectrometry (tandem MS)
Glycan Information
Glycan Annotation Contains rhamnose, 3-O-methyl rhamnose, and galactosamine.
Literature
Year of Identification2005
Year of Identification Month Wise2005.07
ReferenceWaller, L.N., Stump, M.J., Fox, K.F., Harley, W.M., Fox, A., Stewart, G.C. and Shahgholi, M. (2005) Identification of a second collagen-like glycoprotein produced by Bacillus anthracis and demonstration of associated spore-specific sugars. J Bacteriol, 187, 4592-4597. [PubMed: 15968070]
Author Waller, L.N., Stump, M.J., Fox, K.F., Harley, W.M., Fox, A., Stewart, G.C. Shahgholi, M.
Research GroupDepartment of Pathology and Microbiology, University of South Carolina School of Medicine, Columbia, South Carolina 29208, USA.
Corresponding Author Shahgholi, M.
ContactDepartment of Pathology and Microbiology, University of South Carolina School of Medicine, Columbia, South Carolina 29208, USA.