ProGP249

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP249
Validation Status Uncharacterized
Organism Information
Organism NameAeromonas caviae (punctata) UU 51
Domain Bacteria
Classification Family: Aeromonadaceae
Order: Aeromonadales
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 648
Genome Sequence(s)
GenBank AY839592
EMBL AY839592
Gene Information
Gene NameflaB
Protein Information
Protein NameFlagellin B
UniProtKB/SwissProt ID Q5MBN0
EMBL-CDSAAW21727.1
UniProtKB Sequence >tr|Q5MBN0|Q5MBN0_AERPU Flagellin B OS=Aeromonas punctata GN=flaB PE=4 SV=1 MAMFINTNTSSLNAQRNLMNTTKSLDTSYTRLASGLRINSAKDDAAGLQISNRLTSQVNG LDQGNRNANDGISLAQTAEGAMDEVTGMLQRMRTLAQQSANGSNSAKDREALQKEVDQLG AEINRISKDTTFAGTKLLDGNYSGSFQVGADANQTIGFSLSQADGFSISGIAAAANTTVD VGTVIGTAINVTAIFAAGSSISISTQNGAQQVLAAADAMLGVVDSKRAELGAVQNRLDST IRNQANISENVSAARSRIRDADFATETANMTKQNILQQAASSILAQANQRPQSALQLLG
Sequence length 299 AA
Subcellular LocationFlagellum
Function Flagellin is the subunit protein which polymerizes to form the filaments of flagella.
Glycosylation Status
Glycosylation Type O- (Ser/Thr) linked
Technique(s) used for Glycosylation DetectionTop-down mass spectrometry (MS) approach involving Intact mass analysis (indicating mass excess) and product ion mass spectra (CID).
Glycan Information
Glycan Annotation O-Linkage Ser/Thr. Glycosylated with structurally related monosaccharides of N-acetylpseudaminic acid (Pse5Ac7Ac8Ac).
Protein Glycosylation linked (PGL) gene(s)
OST ProGT IDProGT55
Accessory Gene(s)Progt IDProGT55.1-ProGT55.7
Literature
Year of Identification2005
Year of Identification Month Wise2005.12
ReferenceSchirm, M., Schoenhofen, I.C., Logan, S.M., Waldron, K.C. and Thibault, P. (2005) Identification of unusual bacterial glycosylation by tandem mass spectrometry analyses of intact proteins. Anal Chem, 77, 7774-7782. [PubMed: 16316188]
Author Schirm, M., Schoenhofen, I.C., Logan, S.M., Waldron, K.C. Thibault, P.
Research GroupDepartment of Chemistry, University of Montreal, Quebec, Canada.
Corresponding Author Thibault, P.
ContactDepartment of Chemistry, University of Montreal, Quebec, Canada.