ProGP252

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP252
Validation Status Characterized
Organism Information
Organism NamePseudomonas aeruginosa PAO1
Domain Bacteria
Classification Family: Pseudomonadaceae
Order: Pseudomonadales
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 287
Genome Sequence(s)
GenBank AE004091.2
EMBL AE004091
Organism Additional Information This Gram-negative opportunistic pathogen is responsible for nosocomial pneumonia. Its virulence factors include exotoxins, proteases, lipases, lipopolysaccharide (LPS), pili, and flagellin protein.
Gene Information
Gene NamefliC (PA1092)
NCBI Gene ID 882052
GenBank Gene Sequence 882052
Protein Information
Protein NameType b Flagellin
UniProtKB/SwissProt ID P72151
NCBI RefSeq NP_249783.1
EMBL-CDSAAG04481.1
UniProtKB Sequence >sp|P72151|FLICB_PSEAE B-type flagellin OS=Pseudomonas aeruginosa GN=fliC PE=1 SV=2 MALTVNTNIASLNTQRNLNASSNDLNTSLQRLTTGYRINSAKDDAAGLQISNRLSNQISG LNVATRNANDGISLAQTAEGALQQSTNILQRIRDLALQSANGSNSDADRAALQKEVAAQQ AELTRISDTTTFGGRKLLDGSFGTTSFQVGSNAYETIDISLQNASASAIGSYQVGSNGAG TVASVAGTATASGIASGTVNLVGGGQVKNIAIAAGDSAKAIAEKMDGAIPNLSARARTVF TADVSGVTGGSLNFDVTVGSNTVSLAGVTSTQDLADQLNSNSSKLGITASINDKGVLTIT SATGENVKFGAQTGTATAGQVAVKVQGSDGKFEAAAKNVVAAGTAATTTIVTGYVQLNSP TAYSVSGTGTQASQVFGNASAAQKSSVASVDISTADGAQNAIAVVDNALAAIDAQRADLG AVQNRFKNTIDNLTNISENATNARSRIKDTDFAAETAALSKNQVLQQAGTAILAQANQLP QAVLSLLR
Sequence length 488 AA
Subcellular LocationSecreted
Function Flagellin is the subunit protein which polymerizes to form the filaments of bacterial flagella. It has been shown to have a role in the stimulation of inflammatory response via Toll-like receptor 5.
Glycosylation Status
Glycosylation Type O (Ser) linked
Experimentally Validated Glycosite(s) in Full Length Protein(Initiator Met removed) S192, S196
Experimentally Validated Glycosite(s ) in Mature ProteinS191, S195
Glycosite(s) Annotated Protein Sequence >sp|P72151|FLICB_PSEAE B-type flagellin OS=Pseudomonas aeruginosa GN=fliC PE=1 SV=2 MALTVNTNIASLNTQRNLNASSNDLNTSLQRLTTGYRINSAKDDAAGLQISNRLSNQISG LNVATRNANDGISLAQTAEGALQQSTNILQRIRDLALQSANGSNSDADRAALQKEVAAQQ AELTRISDTTTFGGRKLLDGSFGTTSFQVGSNAYETIDISLQNASASAIGSYQVGSNGAG TVASVAGTATAS*(192)GIAS*(196)GTVNLVGGGQVKNIAIAAGDSAKAIAEKMDGAIPNLSARARTVF TADVSGVTGGSLNFDVTVGSNTVSLAGVTSTQDLADQLNSNSSKLGITASINDKGVLTIT SATGENVKFGAQTGTATAGQVAVKVQGSDGKFEAAAKNVVAAGTAATTTIVTGYVQLNSP TAYSVSGTGTQASQVFGNASAAQKSSVASVDISTADGAQNAIAVVDNALAAIDAQRADLG AVQNRFKNTIDNLTNISENATNARSRIKDTDFAAETAALSKNQVLQQAGTAILAQANQLP QAVLSLLR
Sequence Around Glycosites (21 AA) VASVAGTATASGIASGTVNLV
AGTATASGIASGTVNLVGGGQ
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionNanoES-MS (nanoelectrospray mass spectrometry) for intact mass analysis
Technique(s) used for Glycosylated Residue(s) Detection LC-ES-MS/MS (liquid chromatography electrospray tandem mass spectrometry) analysis analysis of chymotryptic or tryptic digests of the protein after β-elimination with ammonium hydroxide.
Glycan Information
Glycan Annotation Linkage: Deoxyhexose-Ser.
(356 Da) A single deoxyhexose monosaccharide linked to a unique modification of mass 209 Da which contains a phosphate moiety.
Technique(s) used for Glycan Identification Intact mass analysis of flagellin by nanoelectrospray MS and LC-nES-MS/MS (liquid chromatography-nanoelectrospray tandem mass spectrometry) analysis of chymotryptic or tryptic digests of the protein.
Protein Glycosylation linked (PGL) gene(s)
OST Gene NamePilO (TfpO)
OST ProGT IDProGT1
Characterized Accessory Gene(s)FgtA (PA1091) is the glycosyltransferase that adds the deoxyhexose to the protein. PA1088 enzyme attaches the 209-Da modification to the deoxyhexose. PA1088, PA1089, PA1090, PA1091 constitute the flagellin glycosylation island.
Accessory Gene(s)Progt IDProGT1.2-ProGT1.2
Literature
Year of Identification2006
Year of Identification Month Wise2008.10.1
Year of Validation 2006
Reference1) Verma, A., Schirm, M., Arora, S.K., Thibault, P., Logan, S.M. and Ramphal, R. (2006) Glycosylation of b-Type flagellin of Pseudomonas aeruginosa: structural and genetic basis. J Bacteriol, 188, 4395-4403. [PubMed: 16740946]
AuthorVerma, A., Schirm, M., Arora, S.K., Thibault, P., Logan, S.M. and Ramphal, R.
Research GroupDepartment of Medicine/Infectious Diseases, P.O. Box 100277, JHMHC, University of Florida, Gainesville, FL 32610, USA.
Corresponding Author Ramphal, R.
ContactDepartment of Medicine/Infectious Diseases, P.O. Box 100277, JHMHC, University of Florida, Gainesville, FL 32610, USA.