ProGP254 (Dps (18 kDa), Stress inducible DNA binding protein)

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP254 (Dps (18 kDa), Stress inducible DNA binding protein)
Validation Status Uncharacterized
Organism Information
Organism NameSalmonella enterica serovar Typhimurium
Domain Bacteria
Classification Family: Enterobacteriaceae
Order: "Enterobacteriales"
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 90371
Genome Information
GenBank AE006468.1
EMBL AE006468
Organism Additional Information Salmonella enterica is a primary enteric pathogen causing gastrointestinal (mostly food-borne) disease in humans and animals.
Gene Information
Gene Namedps (STM0831)
NCBI Gene ID 1252350
GenBank Gene Sequence NC_003197
Protein Information
Protein NameDps (18 kDa), Stress inducible DNA binding protein
UniProtKB/SwissProt ID Q7CQV9
NCBI RefSeq NP_459808.1
EMBL-CDSAAL19767.1
UniProtKB Sequence >sp|Q7CQV9|DPS_SALTY DNA protection during starvation protein OS=Salmonella typhimurium GN=dps PE=3 SV=3 MSTAKLVKTKASNLLYTRNDVSESDKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFI AVHEMLDGFRTALTDHLDTMAERAVQLGGVALGTTQVINSKTPLKSYPLDIHNVQDHLKE LADRYAVVANDVRKAIGEAKDEDTADIFTAASRDLDKFLWFIESNIE
Sequence length 167 AA
Subcellular LocationIntracellular
Function Dps is a protein that is produced in large amounts when the bacterial cell faces harm (starvation), which results in DNA protection (DNA biocrystallization). Glycosylated Dps is produced in the pre- and early stationary phases of bacterial growth.
Glycosylation Status
Technique(s) used for Glycosylation DetectionPAS-staining and enzyme-linked lectin assay (jacalin, conA, KM+)
Glycan Information
Glycan Annotation Mannose, glucose, and an unknown sugar residue.
Literature
Year of Identification2007
Year of Identification Month Wise2007.04
ReferenceHanna, E.S., Roque-Barreira, M.C., Bernardes, E.S., Panunto-Castelo, A., Sousa, M.V., Almeida, I.C. and Brocchi, M. (2007) Evidence for glycosylation on a DNA-binding protein of Salmonella enterica. Microb Cell Fact, 6, 11. [PubMed: 17407574]
Author Brocchi, M.
Research GroupDepartment of Cellular and Molecular Biology and Pathogenic Bioagents, School of Medicine of Ribeirão Preto, University of São Paulo, Av, Bandeirantes 3900, Ribeirão Preto, SP 14049-900, Brazil.
Corresponding Author Hanna, E.S., Roque-Barreira, M.C., Bernardes, E.S., Panunto-Castelo, A., Sousa, M.V., Almeida, I.C. Brocchi, M.
ContactDepartment of Cellular and Molecular Biology and Pathogenic Bioagents, School of Medicine of Ribeirão Preto, University of São Paulo, Av, Bandeirantes 3900, Ribeirão Preto, SP 14049-900, Brazil.