ProGP257 (Microcystin-related protein C (MrpC))

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP257 (Microcystin-related protein C (MrpC))
Validation Status Uncharacterized
Organism Information
Organism NameMicrocystis aeruginosa PCC 7806
Domain Bacteria
Classification Family: Microcystaceae
Order: Chroococcales
Class: Oscillatoriophycideae
Division or phylum: "Cyanobacteria"
Taxonomic ID (NCBI) 1903187
Genome Information
GenBank CP020771.1
EMBL CP020771
Organism Additional Information A toxic, unicellular and colonial cyanobacterium.
Gene Information
Gene NamemrpC (BH695_0840)
Protein Information
Protein NameMicrocystin-related protein C (MrpC)
UniProtKB/SwissProt ID A0A1X9LBG1
NCBI RefSeq WP_002740481.1
EMBL-CDSARI80121.1
UniProtKB Sequence >tr|A0A1X9LBG1|A0A1X9LBG1_MICAE Uncharacterized protein OS=Microcystis aeruginosa PCC 7806SL OX=1903187 GN=BH695_0840 PE=4 SV=1 MKASNYQEIARGAILAGGLAAAGVLSVGEGAQAQFIGTASQSRVSAATTSILTDGNTAAT NSFAVEQVLPAADYVFSSPISVQISYDTLTLAKDKNFVAITGAVLTATVEVNSGTQLTVE RATADAISQAAAASQFGDVSGIVRAWTAGTSVLD
Sequence length 154 AA
Subcellular LocationSurface
Function Role in cellular interactions. Microcystins, the most common cyanobacterial toxins (potent hepatotoxins), are implicated in colony specificity of and colony formation by Microcystis.
Glycosylation Status
Glycosylation Type O-linked
Technique(s) used for Glycosylation DetectionDigoxigenin-glycan detection kit
Glycan Information
Glycan Annotation O-GlcNAc modifications though the exact glycan structure is unknown
Technique(s) used for Glycan Identification Western blotting using antibody against O-linked GlcNAc residues
Literature
Year of Identification2008
Year of Identification Month Wise2008.04
ReferenceZilliges Y, Kehr JC, Mikkat S, Bouchier C, de Marsac NT, Börner T, Dittmann E. (2008) An extracellular glycoprotein is implicated in cell-cell contacts in the toxic cyanobacterium Microcystis aeruginosa PCC 7806. J Bacteriol., 190(8), 2871-9. [PubMed: 18281396]
AuthorZilliges Y, Kehr JC, Mikkat S, Bouchier C, de Marsac NT, Börner T, Dittmann E.
Research GroupHumboldt University Berlin, Institute of Biology, Molecular Ecology and Genetics, Chausseestr. 117, 10115 Berlin, Germany.
Corresponding Author Dittmann E.
ContactHumboldt University Berlin, Institute of Biology, Molecular Ecology and Genetics, Chausseestr. 117, 10115 Berlin, Germany.