ProGP26

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP26
Validation Status Uncharacterized
Organism Information
Organism NameCellulomonas fimi ATCC 484
Domain Bacteria
Classification Family: Cellulomonadaceae
Suborder: Micrococcineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 1708
Genome Sequence(s)
GenBank M15823
EMBL M15823
Gene Information
Gene NamecenA
Protein Information
Protein NameCenA (Endoglucanase A)
UniProtKB/SwissProt ID P07984
EMBL-CDSAAA23084.1
UniProtKB Sequence >sp|P07984|GUNA_CELFI Endoglucanase A OS=Cellulomonas fimi GN=cenA PE=1 SV=1 MSTRRTAAALLAAAAVAVGGLTALTTTAAQAAPGCRVDYAVTNQWPGGFGANVTITNLGD PVSSWKLDWTYTAGQRIQQLWNGTASTNGGQVSVTSLPWNGSIPTGGTASFGFNGSWAGS NPTPASFSLNGTTCTGTVPTTSPTPTPTPTTPTPTPTPTPTPTPTVTPQPTSGFYVDPTT QGYRAWQAASGTDKALLEKIALTPQAYWVGNWADASHAQAEVADYTGRAVAAGKTPMLVV YAIPGRDCGSHSGGGVSESEYARWVDTVAQGIKGNPIVILEPDALAQLGDCSGQGDRVGF LKYAAKSLTLKGARVYIDAGHAKWLSVDTPVNRLNQVGFEYAVGFALNTSNYQTTADSKA YGQQISQRLGGKKFVIDTSRNGNGSNGEWCNPRGRALGERPVAVNDGSGLDALLWVKLPG ESDGACNGGPAAGQWWQEIALEMARNARW
Sequence length 449 AA
Function Endo-β-1,4-glucanase A. EC=3.2.1.4. Involved in cellulose hydrolysis.
Glycosylation Status
Glycosylation Type O- (Thr) linked
Technique(s) used for Glycosylation DetectionPAS-staining and ConA binding
Glycan Information
Glycan Annotation Linkage: Man-O-Thr, Gal-O-Thr.
Literature
Year of Identification1984
Year of Identification Month Wise1984.8
ReferenceOng, E., Kilburn, D.G., Miller, R.C., Jr. and Warren, R.A. (1994) Streptomyces lividans glycosylates the linker region of a beta-1,4-glycanase from Cellulomonas fimi. J Bacteriol, 176, 999-1008. [PubMed: 8106343]
Author Ong, E., Kilburn, D.G., Miller, R.C., Jr. Warren, R.A.
Research GroupDepartment of Microbiology and Immunology, University of British Columbia, Vancouver, Canada.
Corresponding Author Warren, R.A.
ContactDepartment of Microbiology and Immunology, University of British Columbia, Vancouver, Canada.
ReferenceGilkes, N.R., Langsford, M.L., Kilburn, D.G., Miller, R.C., Jr. and Warren, R.A. (1984) Mode of action and substrate specificities of cellulases from cloned bacterial genes. J Biol Chem, 259, 10455-10459. [PubMed: 6432782]
AuthorGilkes, N.R., Langsford, M.L., Kilburn, D.G., Miller, R.C., Jr. Warren, R.A.
Research GroupDepartment of Microbwbgy, University of British Columbia, Vancouver, British Columbia, Cada
Corresponding Author Warren, R.A.
ContactDepartment of Microbwbgy, University of British Columbia, Vancouver, British Columbia, Cada