ProGP263

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP263
Validation Status Characterized
Organism Information
Organism NameMycobacterium tuberculosis
Domain Bacteria
Classification Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 1773
Genome Sequence(s)
GenBank BX842583.1
EMBL BX842583
Organism Additional Information It is the causative agent of human tuberculosis. The pathogenesis is influenced by its lipoglycans and glycolipids (having a wide range of immunomodulatory activities), and a variety of its virulence factors and antigens.
Gene Information
Gene Name(Rv3491)
NCBI Gene ID 888382
Protein Information
Protein NameRv3491
UniProtKB/SwissProt ID O06354
NCBI RefSeq NP_218008.1
EMBL-CDSCAB08714.1
UniProtKB Sequence >tr|O06354|O06354_MYCTU Putative uncharacterized protein OS=Mycobacterium tuberculosis GN=MT3595 PE=4 SV=1 MNIRCGLAAGAVICSAVALGIALHSGDPARALGPPPDGSYSFNQAGVSGVTWTITALCDQ PSGTRNMNDYSDPIVWAFNCALNVVSTTPQQITRTDRLQNFSGRARMSSMLWTFQVNQAD GVACPDGSTAPSSETYAFSDETLTGTHTTVHGAVCGLQPKLSKQPFSLQLIGPPPSPVQR YPLYCNNIAMCY
Sequence length 192 AA
Glycosylation Status
Glycosylation Type O- (Ser) linked
Experimentally Validated Glycosite(s) in Full Length ProteinS176
Glycosite(s) Annotated Protein Sequence >tr|O06354|O06354_MYCTU Putative uncharacterized protein OS=Mycobacterium tuberculosis GN=MT3595 PE=4 SV=1 MNIRCGLAAGAVICSAVALGIALHSGDPARALGPPPDGSYSFNQAGVSGVTWTITALCDQ PSGTRNMNDYSDPIVWAFNCALNVVSTTPQQITRTDRLQNFSGRARMSSMLWTFQVNQAD GVACPDGSTAPSSETYAFSDETLTGTHTTVHGAVCGLQPKLSKQPFSLQLIGPPPS*(176)PVQR YPLYCNNIAMCY
Sequence Around Glycosites (21 AA) FSLQLIGPPPSPVQRYPLYCN
Technique(s) used for Glycosylation DetectionConcanavalin A (ConA) binding
Literature
Year of Identification2009
Year of Identification Month Wise2009.02
ReferenceGonzález-Zamorano M1, Mendoza-Hernández G, Xolalpa W, Parada C, Vallecillo AJ, Bigi F, Espitia C (2009) .Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins.J Proteome Res. 2009 Feb;8(2):721-33. doi: 10.1021/pr800756a
AuthorGonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C
Research GroupDepartment of Immunology, Institute of Biomedical Research, National Autonomous University of Mexico, Mexico.
Corresponding Author Espitia, C
ContactDepartment of Immunology, Institute of Biomedical Research, National Autonomous University of Mexico, Mexico.
ReferenceSmith GT, Sweredoski MJ, Hess S.(2013) O-linked glycosylation sites profiling in Mycobacterium tuberculosis culture filtrate proteins. J Proteomics. 2014 Jan 31;97:296-306. doi: 10.1016/j.jprot.2013.05.011. Epub 2013 May 20.
AuthorSmith GT, Sweredoski MJ, Hess S.
Research GroupProteome Exploration Laboratory, Beckman Institute, California Institute of Technology, Pasadena, CA, USA.
Corresponding Author Hess S.
ContactProteome Exploration Laboratory, Beckman Institute, California Institute of Technology, Pasadena, CA, USA.