ProGP264

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP264
Validation Status Characterized
Organism Information
Organism NameMycobacterium tuberculosis
Domain Bacteria
Classification Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 1773
Genome Sequence(s)
GenBank BX842575.1
EMBL BX842575
Organism Additional Information It is the causative agent of human tuberculosis. The pathogenesis is influenced by its lipoglycans and glycolipids (having a wide range of immunomodulatory activities), and a variety of its virulence factors and antigens.
Gene Information
Gene NameRv1096
NCBI Gene ID 885949
Protein Information
Protein NameGlycosyl hydrolase
UniProtKB/SwissProt ID O53444
NCBI RefSeq NP_215612.1
EMBL-CDSCAA17212.1
UniProtKB Sequence >tr|O53444|O53444_MYCTU POSSIBLE GLYCOSYL HYDROLASE OS=Mycobacterium tuberculosis GN=MT1128 PE=4 SV=1 MPKRPDNQTWRYWRTVTGVVVAGAVLVVGGLSGRVTRAENLSCSVIKCVALTFDDGPGPY TDRLLHILTDNDAKATFFLIGNKVAANPAGARRIADAGMEIGSHTWEHPNMTTIPPEDIP GQFSRANDVIAAATGRTPTLYRPAGGLSNDAVRQAAAKVGQAEILWDVIPFDWINDSNTA ATRHMLMTQIKPGSVVLFHDTYSSTVDVVYQFIPVLKANGYRLVTVSELLGPRAPGSSYG SRENGPPVNELRDIPASEIPPLPNTSSPKPMPNFPITDIAGQNSGGPNNGA
Sequence length 291 AA
Function Glycosyl hydrolase
Glycosylation Status
Glycosylation Type O (Ser/Thr) linked
Experimentally Validated Glycosite(s) in Full Length ProteinT265, S266 and S267
Glycosite(s) Annotated Protein Sequence >tr|O53444|O53444_MYCTU POSSIBLE GLYCOSYL HYDROLASE OS=Mycobacterium tuberculosis GN=MT1128 PE=4 SV=1 MPKRPDNQTWRYWRTVTGVVVAGAVLVVGGLSGRVTRAENLSCSVIKCVALTFDDGPGPY TDRLLHILTDNDAKATFFLIGNKVAANPAGARRIADAGMEIGSHTWEHPNMTTIPPEDIP GQFSRANDVIAAATGRTPTLYRPAGGLSNDAVRQAAAKVGQAEILWDVIPFDWINDSNTA ATRHMLMTQIKPGSVVLFHDTYSSTVDVVYQFIPVLKANGYRLVTVSELLGPRAPGSSYG SRENGPPVNELRDIPASEIPPLPNT*(265)S*(266)S*(267)PKPMPNFPITDIAGQNSGGPNNGA
Sequence Around Glycosites (21 AA) PASEIPPLPNTSSPKPMPNFP
ASEIPPLPNTSSPKPMPNFPI
SEIPPLPNTSSPKPMPNFPIT
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionConcanavalin A (ConA) binding
Literature
Year of Identification2009
Year of Identification Month Wise2009.02
ReferenceGonzález-Zamorano M1, Mendoza-Hernández G, Xolalpa W, Parada C, Vallecillo AJ, Bigi F, Espitia C (2009) .Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins.J Proteome Res. 2009 Feb;8(2):721-33. doi: 10.1021/pr800756a
AuthorGonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C
Research GroupDepartamento de Inmunologia, Instituto de Investigaciones Biomedicas, Universidad Nacional Autonoma de Mexico, Mexico.
Corresponding Author Espitia, C
ContactDepartamento de Inmunologia, Instituto de Investigaciones Biomedicas, Universidad Nacional Autonoma de Mexico, Mexico.