ProGP265

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP265
Validation Status Characterized
Organism Information
Organism NameMycobacterium tuberculosis
Domain Bacteria
Classification Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 1773
Genome Sequence(s)
GenBank BX842580.1
EMBL BX842580
Organism Additional Information It is the causative agent of human tuberculosis. The pathogenesis is influenced by its lipoglycans and glycolipids (having a wide range of immunomodulatory activities), and a variety of its virulence factors and antigens.
Gene Information
Gene NameRv2799
NCBI Gene ID 887759
Protein Information
Protein NameRv2799
UniProtKB/SwissProt ID P71652
NCBI RefSeq NP_217315.1
EMBL-CDSCAB03647.1
UniProtKB Sequence >tr|P71652|P71652_MYCTU PROBABLE MEMBRANE PROTEIN OS=Mycobacterium tuberculosis GN=MT2867.1 PE=4 SV=1 MYTPGKGPPRAGGVVFTRVRLIGGLGALTAAVVVVGTVGWQGIPPAPTGGDAVQLRSTAA PMSTTMKSPIVATTDPSPFDPCRDIPFDVIQRLGLAYTPPEAEEGLRCHFDAGNYQMAVE PIIWRTYAQTLPPDAIETTIAGHRAAQYWVRKPTYHNSFWYSSCMVTFKTSYGVIQQSLF YSTVYSEPDVDCPSTNLQRANDLVPYYRF
Sequence length 209 AA
Subcellular LocationMembrane
Glycosylation Status
Glycosylation Type O (Ser/Thr) linked
Experimentally Validated Glycosite(s) in Full Length ProteinS68, T73, T74 and S77
Glycosite(s) Annotated Protein Sequence >tr|P71652|P71652_MYCTU PROBABLE MEMBRANE PROTEIN OS=Mycobacterium tuberculosis GN=MT2867.1 PE=4 SV=1 MYTPGKGPPRAGGVVFTRVRLIGGLGALTAAVVVVGTVGWQGIPPAPTGGDAVQLRSTAA PMSTTMKS*(68)PIVAT*(73)T*(74)DPS*(77)PFDPCRDIPFDVIQRLGLAYTPPEAEEGLRCHFDAGNYQMAVE PIIWRTYAQTLPPDAIETTIAGHRAAQYWVRKPTYHNSFWYSSCMVTFKTSYGVIQQSLF YSTVYSEPDVDCPSTNLQRANDLVPYYRF
Sequence Around Glycosites (21 AA) TAAPMSTTMKSPIVATTDPSP>STTMKSPIVATTDPSPFDPCR> TTMKSPIVATTDPSPFDPCRD> KSPIVATTDPSPFDPCRDIPF
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionConcanavalin A (ConA) binding
Literature
Year of Identification2009
Year of Identification Month Wise2009.02
ReferenceGonzález-Zamorano M1, Mendoza-Hernández G, Xolalpa W, Parada C, Vallecillo AJ, Bigi F, Espitia C (2009) .Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins.J Proteome Res. 2009 Feb;8(2):721-33. doi: 10.1021/pr800756a
AuthorGonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C
Research GroupDepartamento de Inmunologia, Instituto de Investigaciones Biomedicas, Universidad Nacional Autonoma de Mexico, Mexico.
Corresponding Author Espitia, C
ContactDepartamento de Inmunologia, Instituto de Investigaciones Biomedicas, Universidad Nacional Autonoma de Mexico, Mexico.