ProGP266 (LprA)

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP266 (LprA)
Validation Status Characterized
Organism Information
Organism NameMycobacterium tuberculosis
Domain Bacteria
Classification Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 1773
Genome Information
GenBank BX842576.1
EMBL BX842576
Organism Additional Information It is the causative agent of human tuberculosis. The pathogenesis is influenced by its lipoglycans and glycolipids (having a wide range of immunomodulatory activities), and a variety of its virulence factors and antigens.
Gene Information
Gene NamelprA (Rv1270c)
NCBI Gene ID 887017
GenBank Gene Sequence NC_000962.2
Protein Information
Protein NameLprA
UniProtKB/SwissProt ID P9WK55
NCBI RefSeq NP_215786.1
EMBL-CDSCAB00915.1
UniProtKB Sequence >sp|P9WK55|LPRA_MYCTU Lipoprotein LprA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=lprA PE=1 SV=1 MKHPPCSVVAAATAILAVVLAIGGCSTEGDAGKASDTAATASNGDAAMLLKQATDAMRKV TGMHVRLAVTGDVPNLRVTKLEGDISNTPQTVATGSATLLVGNKSEDAKFVYVDGHLYSD LGQPGTYTDFGNGASIYNVSVLLDPNKGLANLLANLKDASVAGSQQADGVATTKITGNSS ADDIATLAGSRLTSEDVKTVPTTVWIASDGSSHLVQIQIAPTKDTSVTLTMSDWGKQVTA TKPV
Sequence length 244 AA
Subcellular LocationMembrane
Function Putative lipoprotein
Glycosylation Status
Glycosylation Type O- (Ser/Thr) linked
Experimentally Validated Glycosite(s) in Full Length ProteinS35, T37, T40 and S42
Glycosite(s) Annotated Protein Sequence >sp|Q11049|LPRA_MYCTU Putative lipoprotein lprA OS=Mycobacterium tuberculosis GN=lprA PE=1 SV=2 MKHPPCSVVAAATAILAVVLAIGGCSTEGDAGKAS*(35)DT*(37)AAT*(40)AS*(42)NGDAAMLLKQATDAMRKV TGMHVRLAVTGDVPNLRVTKLEGDISNTPQTVATGSATLLVGNKSEDAKFVYVDGHLYSD LGQPGTYTDFGNGASIYNVSVLLDPNKGLANLLANLKDASVAGSQQADGVATTKITGNSS ADDIATLAGSRLTSEDVKTVPTTVWIASDGSSHLVQIQIAPTKDTSVTLTMSDWGKQVTA TKPV
Sequence Around Glycosites (21 AA) CSTEGDAGKASDTAATASNGD
TEGDAGKASDTAATASNGDAA
DAGKASDTAATASNGDAAMLL
GKASDTAATASNGDAAMLLKQ
ProGP Web Logo
Technique(s) used for Glycosylation DetectionConcanavalin A (ConA) binding
Literature
Year of Identification2009
Year of Identification Month Wise2009.02
ReferenceGonzález-Zamorano M, Mendoza-Hernández G, Xolalpa W, Parada C, Vallecillo AJ, Bigi F, Espitia C (2009) .Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins.J Proteome Res. 2009, 8(2), 721-33. [PubMed: 19196185]
AuthorGonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C
Research GroupDepartment of Immunology, Institute of Biomedical Research, National Autonomous University of Mexico, Mexico.
Corresponding Author Espitia, C
ContactDepartment of Immunology, Institute of Biomedical Research, National Autonomous University of Mexico, Mexico.
ReferenceSmith GT, Sweredoski MJ, Hess S.(2014) O-linked glycosylation sites profiling in Mycobacterium tuberculosis culture filtrate proteins. J Proteomics, 97, 296-306. [PubMed: 23702328]
AuthorSmith GT, Sweredoski MJ, Hess S.
Research GroupProteome Exploration Laboratory, Beckman Institute, California Institute of Technology, Pasadena, CA, USA.
Corresponding Author Hess S.
ContactProteome Exploration Laboratory, Beckman Institute, California Institute of Technology, Pasadena, CA, USA.