ProGP266

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP266
Validation Status Characterized
Organism Information
Organism NameMycobacterium tuberculosis
Domain Bacteria
Classification Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 1773
Genome Sequence(s)
GenBank BX842576.1
EMBL BX842576
Organism Additional Information It is the causative agent of human tuberculosis. The pathogenesis is influenced by its lipoglycans and glycolipids (having a wide range of immunomodulatory activities), and a variety of its virulence factors and antigens.
Gene Information
Gene NamelprA (Rv1270c)
NCBI Gene ID 887017
Protein Information
Protein NameLprA
UniProtKB/SwissProt ID Q11049
NCBI RefSeq NP_215786.1
EMBL-CDSCAB00915.1
UniProtKB Sequence >sp|Q11049|LPRA_MYCTU Putative lipoprotein lprA OS=Mycobacterium tuberculosis GN=lprA PE=1 SV=2 MKHPPCSVVAAATAILAVVLAIGGCSTEGDAGKASDTAATASNGDAAMLLKQATDAMRKV TGMHVRLAVTGDVPNLRVTKLEGDISNTPQTVATGSATLLVGNKSEDAKFVYVDGHLYSD LGQPGTYTDFGNGASIYNVSVLLDPNKGLANLLANLKDASVAGSQQADGVATTKITGNSS ADDIATLAGSRLTSEDVKTVPTTVWIASDGSSHLVQIQIAPTKDTSVTLTMSDWGKQVTA TKPV
Sequence length 244 AA
Subcellular LocationCell membrane
Function Putative lipoprotein
Glycosylation Status
Glycosylation Type O (Ser/Thr) linked
Experimentally Validated Glycosite(s) in Full Length ProteinS35, T37, T40 and S42
Glycosite(s) Annotated Protein Sequence >sp|Q11049|LPRA_MYCTU Putative lipoprotein lprA OS=Mycobacterium tuberculosis GN=lprA PE=1 SV=2 MKHPPCSVVAAATAILAVVLAIGGCSTEGDAGKAS*(35)DT*(37)AAT*(40)AS*(42)NGDAAMLLKQATDAMRKV TGMHVRLAVTGDVPNLRVTKLEGDISNTPQTVATGSATLLVGNKSEDAKFVYVDGHLYSD LGQPGTYTDFGNGASIYNVSVLLDPNKGLANLLANLKDASVAGSQQADGVATTKITGNSS ADDIATLAGSRLTSEDVKTVPTTVWIASDGSSHLVQIQIAPTKDTSVTLTMSDWGKQVTA TKPV
Sequence Around Glycosites (21 AA) CSTEGDAGKASDTAATASNGD
TEGDAGKASDTAATASNGDAA
DAGKASDTAATASNGDAAMLL
GKASDTAATASNGDAAMLLKQ
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionConcanavalin A (ConA) binding
Literature
Year of Identification2009
Year of Identification Month Wise2009.02
ReferenceGonzález-Zamorano M1, Mendoza-Hernández G, Xolalpa W, Parada C, Vallecillo AJ, Bigi F, Espitia C (2009) .Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins.J Proteome Res. 2009 Feb;8(2):721-33. doi: 10.1021/pr800756a
AuthorGonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C
Research GroupDepartamento de Inmunologia, Instituto de Investigaciones Biomedicas, Universidad Nacional Autonoma de Mexico, Mexico.
Corresponding Author Espitia, C
ContactDepartamento de Inmunologia, Instituto de Investigaciones Biomedicas, Universidad Nacional Autonoma de Mexico, Mexico.