ProGP268

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP268
Validation Status Uncharacterized
Organism Information
Organism NameMycobacterium tuberculosis
Domain Bacteria
Classification Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 1773
Genome Sequence(s)
GenBank BX842584.1
EMBL BX842584 
Organism Additional Information It is the causative agent of human tuberculosis. The pathogenesis is influenced by its lipoglycans and glycolipids (having a wide range of immunomodulatory activities), and a variety of its virulence factors and antigens.
Gene Information
Gene NamebfrB (Rv3841)
NCBI Gene ID 886176
Protein Information
Protein NameBfrB
UniProtKB/SwissProt ID P96237
NCBI RefSeq NP_218358.1
EMBL-CDSCAB06225.1
UniProtKB Sequence >sp|P96237|BFRB_MYCTU Probable bacterioferritin BfrB OS=Mycobacterium tuberculosis GN=bfrB PE=1 SV=1 MTEYEGPKTKFHALMQEQIHNEFTAAQQYVAIAVYFDSEDLPQLAKHFYSQAVEERNHAM MLVQHLLDRDLRVEIPGVDTVRNQFDRPREALALALDQERTVTDQVGRLTAVARDEGDFL GEQFMQWFLQEQIEEVALMATLVRVADRAGANLFELENFVAREVDVAPAASGAPHAAGGR L
Sequence length 181 AA
Subcellular LocationCytoplasm
Function Probable bacterioferritin (iron storage protein). It is induced under the conditions of hypoxia and repressed by carbon monoxide.
Glycosylation Status
Glycosylation Type Information currently not available with us.
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionConcanavalin A (ConA) binding
Literature
Year of Identification2009
Year of Identification Month Wise2009.2
Reference1) Gonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C. (2009) Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins. J Proteome Res, 8, 721-733. [PubMed: 19196185]
AuthorGonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C
Research GroupDepartamento de Inmunologia, Instituto de Investigaciones Biomedicas, Universidad Nacional Autonoma de Mexico, Mexico.
Corresponding Author Espitia, C
ContactDepartamento de Inmunologia, Instituto de Investigaciones Biomedicas, Universidad Nacional Autonoma de Mexico, Mexico.