ProGP272

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP272
Validation Status Uncharacterized
Organism Information
Organism NameMycobacterium tuberculosis
Domain Bacteria
Classification Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 1773
Genome Sequence(s)
GenBank BX842578.1
EMBL BX842578
Organism Additional Information It is the causative agent of human tuberculosis. The pathogenesis is influenced by its lipoglycans and glycolipids (having a wide range of immunomodulatory activities), and a variety of its virulence factors and antigens.
Gene Information
Gene NamelppL (Rv2138)
NCBI Gene ID 887303
Protein Information
Protein NameLppL
UniProtKB/SwissProt ID O06237
NCBI RefSeq NP_216654.1
EMBL-CDSCAB08655.1
UniProtKB Sequence >tr|O06237|O06237_MYCTU Lipoprotein, putative OS=Mycobacterium tuberculosis GN=lppL PE=4 SV=1 MLTGNKPAVQRRFIGLLMLSVLVAGCSSNPLANFAPGYPPTIEPAQPAVSPPTSQDPAGA VRPLSGHPRAALFDNGTRQLVALRPGADSAAPASIMVFDDVHVAPRVIFLPGPAAALTSD DHGTAFLAARGGYFVADLSSGHTARVNVADAAHTDFTAIARRSDGKLVLGSADGAVYTLA KNPAVDPASGAATVASRTKIFARVDALVTQGNTTVVLDRGQTSVTTIGADGHAQQALRAG QGATTMAADPLGRVLIADTRGGQLLVYGVDPLILRQAYPVRQAPYGLAGSRELAWVSQTA SNTVIGYDLTTGIPVEKVRYPTVQQPNSLAFDETSDTLYVVSGSGAGVQVIEHAAGTR
Sequence length 358 AA
Function Putative lipoprotein
Glycosylation Status
Glycosylation Type Information currently not available with us.
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionConcanavalin A (ConA) binding
Literature
Year of Identification2009
Year of Identification Month Wise2009.2
Reference1) Gonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C. (2009) Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins. J Proteome Res, 8, 721-733. [PubMed: 19196185]
AuthorGonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C
Research GroupDepartamento de Inmunologia, Instituto de Investigaciones Biomedicas, Universidad Nacional Autonoma de Mexico, Mexico.
Corresponding Author Espitia, C
ContactDepartamento de Inmunologia, Instituto de Investigaciones Biomedicas, Universidad Nacional Autonoma de Mexico, Mexico.