ProGP274

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP274
Validation Status Uncharacterized
Organism Information
Organism NameMycobacterium tuberculosis
Domain Bacteria
Classification Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 1773
Genome Sequence(s)
GenBank BX842581.1
EMBL BX842581
Organism Additional Information It is the causative agent of human tuberculosis. The pathogenesis is influenced by its lipoglycans and glycolipids (having a wide range of immunomodulatory activities), and a variety of its virulence factors and antigens.
Gene Information
Gene NamelppZ (Rv3006)
NCBI Gene ID 887308
Protein Information
Protein NameLppZ (Putative lipoprotein)
UniProtKB/SwissProt ID O53253
NCBI RefSeq NP_217522.1
EMBL-CDSCAA16091.1
UniProtKB Sequence >tr|O53253|O53253_MYCTU Lipoprotein, putative OS=Mycobacterium tuberculosis GN=lppZ PE=4 SV=1 MWTTRLVRSGLAALCAAVLVSSGCARFNDAQSQPFTTEPELRPQPSSTPPPPPPLPPVPF PKECPAPGVMQGCLESTSGLIMGIDSKTALVAERITGAVEEISISAEPKVKTVIPVDPAG DGGLMDIVLSPTYSQDRLMYAYISTPTDNRVVRVADGDIPKDILTGIPKGAAGNTGALIF TSPTTLVVMTGDAGDPALAADPQSLAGKVLRIEQPTTIGQTPPTTALSGIGSGGGLCIDP VDGSLYVADRTPTADRLQRITKNSEVSTVWTWPDKPGVAGCAAMDGTVLVNLINTKLTVA VRLAPSTGAVTGEPDVVRKDTHAHAWALRMSPDGNVWGATVNKTAGDAEKLDDVVFPLFP QGGGFPRNNDDKT
Sequence length 373 AA
Glycosylation Status
Technique(s) used for Glycosylation DetectionConcanavalin A (ConA) binding
Literature
Year of Identification2009
Year of Identification Month Wise2009.2
ReferenceGonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C. (2009) Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins. J Proteome Res, 8, 721-733. [PubMed: 19196185]
AuthorGonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C
Research GroupDepartment of Immunology, Institute of Biomedical Research, National Autonomous University of Mexico, Mexico.
Corresponding Author Espitia, C
ContactDepartment of Immunology, Institute of Biomedical Research, National Autonomous University of Mexico, Mexico.