ProGP275

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP275
Validation Status Uncharacterized
Organism Information
Organism NameMycobacterium tuberculosis
Domain Bacteria
Classification Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 1773
Genome Sequence(s)
GenBank BX842582.1
EMBL BX842582
Organism Additional Information It is the causative agent of human tuberculosis. The pathogenesis is influenced by its lipoglycans and glycolipids (having a wide range of immunomodulatory activities), and a variety of its virulence factors and antigens.
Gene Information
Gene NamelpqB (Rv3244c)
NCBI Gene ID 888815
Protein Information
Protein NameLpqB lipoprotein
UniProtKB/SwissProt ID O05889
NCBI RefSeq NP_217761.1
EMBL-CDSCAB08345.1
UniProtKB Sequence >sp|O05889|LPQB_MYCTU Lipoprotein lpqB OS=Mycobacterium tuberculosis GN=lpqB PE=3 SV=4 MERLMRLTILLFLGAVLAGCASVPSTSAPQAIGTVERPVPSNLPKPSPGMDPDVLLREFL KATADPANRHLAARQFLTESASNAWDDAGSALLIDHVVFVETRSAEKVSVTMRADILGSL SDVGVFETAEGQLPDPGPIELVKTSDGWRIDRLPNGVFLDWQQFQETYKRNTLYFADPTG KTVVPDPRYVAVSDRDQLATELVSKLLAGPRPEMARTVRNLLAPPLRLRGPVTRADGGKS GIGRGYGGARVDMEKLSTTDPHSRQLLAAQIIWTLARADIRGPYVINADGAPLEDRFAEG WTTSDVAATDPGVADGAAAGLHALVNGSLVAMDAQRVTPVPGAFGRMPEQTAAAVSRSGR QVASVVTLGRGAPDEAASLWVGDLGGEAVQSADGHSLSRPSWSLDDAVWVVVDTNVVLRA IQDPASGQPARIPVDSTAVASRFPGAINDLQLSRDGTRAAMVIGGQVILAGVEQTQAGQF ALTYPRRLGFGLGSSVVSLSWRTGDDIVVTRTDAAHPVSYVNLDGVNSDAPSRGLQTPLT AIAANPSTVYVAGPQGVLMYSASVESRPGWADVPGLMVPGAAPVLPG
Sequence length 587 AA
Subcellular LocationCell membrane
Function Lipoprotein
Glycosylation Status
Glycosylation Type Information currently not available with us.
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionConcanavalin A (ConA) binding
Literature
Year of Identification2009
Year of Identification Month Wise2009.2
Reference1) Gonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C. (2009) Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins. J Proteome Res, 8, 721-733. [PubMed: 19196185]
AuthorGonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C
Research GroupDepartamento de Inmunologia, Instituto de Investigaciones Biomedicas, Universidad Nacional Autonoma de Mexico, Mexico.
Corresponding Author Espitia, C
ContactDepartamento de Inmunologia, Instituto de Investigaciones Biomedicas, Universidad Nacional Autonoma de Mexico, Mexico.