ProGP279 (LpqT (putative lipoprotein))

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP279 (LpqT (putative lipoprotein))
Validation Status Uncharacterized
Organism Information
Organism NameMycobacterium tuberculosis
Domain Bacteria
Classification Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 1773
Genome Information
GenBank BX842575.1
EMBL BX842575
Organism Additional Information It is the causative agent of human tuberculosis. The pathogenesis is influenced by its lipoglycans and glycolipids (having a wide range of immunomodulatory activities), and a variety of its virulence factors and antigens.
Gene Information
Gene NamelpqT (Rv1016c)
NCBI Gene ID 886066
GenBank Gene Sequence NC_000962
Protein Information
Protein NameLpqT (putative lipoprotein)
UniProtKB/SwissProt ID P9WK59
NCBI RefSeq NP_215532.1
EMBL-CDSCAB06863.1
UniProtKB Sequence >sp|P9WK58|LPQT_MYCTO Putative lipoprotein LpqT OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=lpqT PE=3 SV=1 MAGRRCPQDSVRPLAVAVAVATLAMSAVACGPKSPDFQSILSTSPTTSAVSTTTEVPVPL WKYLESVGVTGEPVAPSSLTDLTVSIPTPPGWAPMKNPNITPNTEMIAKGESYPTAMLMV FKLHRDFDIAEALKHGTADARLSTNFTELDSSTADFNGFPSSMIQGSYDLHGRRLHTWNR IVFPTGAPPAKQRYLVQLTITSLANEAVKHASDIEAIIAGFVVAAK
Sequence length 226 AA
Subcellular LocationMembrane
Function Lipoprotein
Glycosylation Status
Technique(s) used for Glycosylation DetectionConcanavalin A (ConA) binding
Literature
Year of Identification2009
Year of Identification Month Wise2009.2
ReferenceGonzález-Zamorano M, Mendoza-Hernández G, Xolalpa W, Parada C, Vallecillo AJ, Bigi F, Espitia C (2009) .Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins.J Proteome Res. 2009, 8(2), 721-33. [PubMed: 19196185]
AuthorGonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C
Research GroupDepartment of Immunology, Institute of Biomedical Research, National Autonomous University of Mexico, Mexico.
Corresponding Author Espitia, C
ContactDepartment of Immunology, Institute of Biomedical Research, National Autonomous University of Mexico, Mexico.