ProGP280

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP280
Validation Status Uncharacterized
Organism Information
Organism NameMycobacterium tuberculosis
Domain Bacteria
Classification Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 1773
Genome Sequence(s)
GenBank BX842575.1
EMBL BX842575
Organism Additional Information It is the causative agent of human tuberculosis. The pathogenesis is influenced by its lipoglycans and glycolipids (having a wide range of immunomodulatory activities), and a variety of its virulence factors and antigens.
Gene Information
Gene NamelpqW (Rv1166)
NCBI Gene ID 886036
Protein Information
Protein NameLpqW (lipoprotein)
UniProtKB/SwissProt ID P9WGU7
NCBI RefSeq WP_003406102.1
EMBL-CDSCCP43922.1
UniProtKB Sequence >sp|P9WGU7|LPQW_MYCTU Probable monoacyl phosphatidylinositol tetramannoside-binding protein LpqW OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=lpqW PE=1 SV=1 MGVPSPVRRVCVTVGALVALACMVLAGCTVSPPPAPQSTDTPRSTPPPPRRPTQIIMGID WIGPGFNPHLLSDLSPVNAAISALVLPSAFRPIPDPNTPTGSRWEMDPTLLVSADVTNNH PFTVTYKIRPEAQWTDNAPIAADDFWYLWQQMVTQPGVVDPAGYHLITSVQSLEGGKQAV VTFAQPYPAWRELFTDILPAHIVKDIPGGFASGLARALPVTGGQFRVENIDPQRDEILIA RNDRYWGPPSKPGIILFRRAGAPAALADSVRNGDTQVAQVHGGSAAFAQLSAIPDVRTAR IVTPRVMQFTLRANVPKLADTQVRKAILGLLDVDLLAAVGAGTDNTVTLDQAQIRSPSDP GYVPTAPPAMSSAAALGLLEASGFQVDTNTSVSPAPSVPDSTTTSVSTGPPEVIRGRISK DGEQLTLVIGVAANDPTSVAVANTAADQLRDVGIAATVLALDPVTLYHDALNDNRVDAIV GWRQAGGNLATLLASRYGCPALQATTVPAANAPTTAPSAPIGPTPSAAPDTATPPPTAPR RPSDPGALVKAPSNLTGICDRSIQSNIDAALNGTKNINDVITAVEPRLWNMSTVLPILQD TTIVAAGPSVQNVSLSGAVPVGIVGDAGQWVKTGQ
Sequence length 635 AA
Function Probable monoacyl phosphatidylinositol tetramannoside-binding protein LpqW; May directly or indirectly regulate the accessibility of the key branch point intermediate, monoacyl phosphatidylinositol tetramannoside (AcPIM4), to the elongating alpha-1,6 mannosyltransferases which could regulate the lipoarabinomannans (LAMs) biosynthesis.
Glycosylation Status
Technique(s) used for Glycosylation DetectionConcanavalin A (ConA) binding
Literature
Year of Identification2009
Year of Identification Month Wise2009.2
ReferenceGonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C. (2009) Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins. J Proteome Res, 8, 721-733. [PubMed: 19196185]
AuthorGonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C
Research GroupDepartment of Immunology, Institute of Biomedical Research, National Autonomous University of Mexico, Mexico.
Corresponding Author Espitia, C
ContactDepartment of Immunology, Institute of Biomedical Research, National Autonomous University of Mexico, Mexico.