ProGP283

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP283
Validation Status Uncharacterized
Organism Information
Organism NameMycobacterium tuberculosis
Domain Bacteria
Classification Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 1773
Genome Sequence(s)
GenBank BX842576.1
EMBL BX842576
Organism Additional Information It is the causative agent of human tuberculosis. The pathogenesis is influenced by its lipoglycans and glycolipids (having a wide range of immunomodulatory activities), and a variety of its virulence factors and antigens.
Gene Information
Gene NameoppA (Rv1280c)
NCBI Gene ID 886985
Protein Information
Protein NameOppA
UniProtKB/SwissProt ID P66771
NCBI RefSeq NP_215796.1
EMBL-CDSCAB00902.1
UniProtKB Sequence >sp|P66771|Y1280_MYCTU Uncharacterized protein Rv1280c/MT1317 OS=Mycobacterium tuberculosis GN=Rv1280c PE=3 SV=1 MADRGQRRGCAPGIASALRASFQGKSRPWTQTRYWAFALLTPLVVAMVLTGCSASGTQLE LAPTADRRAAVGTTSDINQQDPATLQDGGNLRLSLTDFPPNFNILHIDGNNAEVAAMMKA TLPRAFIIGPDGSTTVDTNYFTSIELTRTAPQVVTYTINPEAVWSDGTPITWRDIASQIH AISGADKAFEIASSSGAERVASVTRGVDDRQAVVTFAKPYAEWRGMFAGNGMLLPASMTA TPEAFNKGQLDGPGPSAGPFVVSALDRTAQRIVLTRNPRWWGARPRLDSITYLVLDDAAR LPALQNNTIDATGVGTLDQLTIAARTKGISIRRAPGPSWYHFTLNGAPGSILADKALRLA IAKGIDRYTIARVAQYGLTSDPVPLNNHVFVAGQDGYQDNSGVVAYNPEQAKRELDALGW RRSGAFREKDGRQLVIRDLFYDAQSTRQFAQIAQHTLAQIGVKLELQAKSGSGFFSDYVN VGAFDIAQFGWVGDAFPLSSLTQIYASDGESNFGKIGSPQIDAAIERTLAELDPGKARAL ANQVDELIWAEGFSLPLTQSPGTVAVRSTLANFGATGLADLDYTAIGFMRR
Sequence length 591 AA
Subcellular LocationCell membrane
Function Periplasmic oligopeptide-binding lipoprotein.
Glycosylation Status
Glycosylation Type Information currently not available with us.
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionConcanavalin A (ConA) binding
Literature
Year of Identification2009
Year of Identification Month Wise2009.2
Reference1) Gonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C. (2009) Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins. J Proteome Res, 8, 721-733. [PubMed: 19196185]
AuthorGonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C
Research GroupDepartamento de Inmunologia, Instituto de Investigaciones Biomedicas, Universidad Nacional Autonoma de Mexico, Mexico.
Corresponding Author Espitia, C
ContactDepartamento de Inmunologia, Instituto de Investigaciones Biomedicas, Universidad Nacional Autonoma de Mexico, Mexico.